KEGG   Brachypodium distachyon: 100827025Help
Entry
100827025         CDS       T01717                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00620  Pyruvate metabolism
bdi00640  Propanoate metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100827025
   00620 Pyruvate metabolism
    100827025
   00640 Propanoate metabolism
    100827025
Enzymes [BR:bdi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100827025
Lipid biosynthesis proteins [BR:bdi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100827025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 100827025
NCBI-ProteinID: XP_003579666
UniProt: A0A0Q3H2T2
Position
5
AA seq 738 aa AA seqDB search
MAQYIYATATRHCCSPRVHPAIPLQVPAPLAPPSSRPLRVSPLRRRWAMGASDRLKVADA
RPRHAGPCAATMLGEPLPASDDHGLVHPSADFSAQALVSSPQQYQEMYQRSIDDPAGFWS
EIAETFYWKQKWSPDEVCTENLDVTKGPIKIEWFKGGKTNICYNAVDRHVEAGDGEKIAM
YWEGNEPDQDGKLTYSALLDKVCQLANYLKSVGVGKGDAVVIYLPMLMELPIAMLACARI
GAVHSVVFAGFSADALAQRITDCKPKVVITCNAVKRGPKLIPLKDIVDASLVQSAKNGVS
VGICLTYENQLAMKKENTRWITGTDVWWQDVVPNFPTRCDMEWVDAEDPLFLLYTSGSTG
KPKGVLHTTGGYMVYTASTFKHAFDYKPTDIYWCTADCGWITGHSYVTYGPLLNGAIVLL
YEGAPNYPNPGRCWDIVDKYGVTIFYTAPTLVRSLMRDGSEYVDQYSRKSLRVLGSVGEP
INPTAWRWFYNVVGNSRCPISDTWWQTETGGFMITPLPGAWPQKPGSATFPFFGVQPVIV
DEKGREMEGECSGYLCIKKSWPGAFRTLFGDKDRYETTYFKPFSGYYFSGDGCRRDKDGY
HWLTGRVDDVINVSGHRIGTAEVESALVSHPKCAEAAVVGIDHEVKGQGIYAFVTLVDGI
PYSDDLRKSLVMTVRSQIGAFAAPDKIHWAPGLPKTRSGKIMRRILRKIASRQLDELGDT
STLADPGVVDQLITLSDT
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatatatacgccaccgccacccgccactgctgctccccgcgcgtccacccc
gcgatcccgctccaggttcccgctcctctagccccgccgtcgtctcggccgcttcgggta
tcgccgctccggcggaggtgggccatgggcgccagcgatcgcctgaaggtggccgacgcc
aggccgcggcatgcggggccatgcgcggctaccatgctgggcgagccgctgccggcgtcc
gacgaccacggcctcgtccaccccagcgccgacttctccgcccaggccctcgtctcctct
ccgcagcagtaccaggagatgtaccagcggtctatcgatgatcctgcaggattctggtcg
gagatcgcagagacgttctactggaagcagaagtggagccctgatgaagtctgtaccgag
aaccttgatgtgacaaagggaccgatcaagatcgaatggtttaaagggggcaaaacaaac
atatgctacaatgccgtggaccgccatgtggaagctggagatggtgagaagattgcgatg
tattgggaggggaatgaacctgatcaggatggaaagctcacatactcagcactcttggat
aaggtttgccagctagcaaactacttgaaaagtgttggagttggaaaaggtgatgccgtg
gttatctacttgcctatgttgatggagctgcctattgcaatgcttgcctgtgcacgcatt
ggtgctgttcactctgttgtgtttgctggcttctctgctgatgcacttgcgcaaagaatc
actgactgcaagcctaaggttgtgattacatgcaatgcggtgaaaagggggccgaaactc
atccctctcaaagatatagtagatgcatctctggttcaaagtgcaaagaatggcgtctct
gtaggcatttgtttgacatatgaaaatcagttagccatgaagaaagagaacacacgatgg
ataacaggaacagatgtgtggtggcaggatgttgtgcccaatttcccaactagatgtgat
atggaatgggttgatgcagaggatccattgtttcttctatacacaagtggcagcacagga
aagccaaagggtgtattgcatacaactgggggctatatggtgtacactgcatcaacattt
aagcatgcatttgattacaagccaacagacatatactggtgcactgcagactgtggctgg
attactggacatagttatgtgacctatggtcctctcctgaatggagccatagttcttctt
tacgaaggggctccaaactaccctaatcctggtcggtgctgggacatcgttgacaaatac
ggggtgacaatattctataccgctccaacacttgtccgttcactcatgcgtgatggtagt
gagtatgttgaccagtactctcgtaaatctctaagagttctcggaagtgtgggtgagcca
ataaatcccactgcatggaggtggttctataatgttgtcgggaactcaagatgccccata
tcagacacttggtggcagactgaaactggtggttttatgattactcctttacctggtgct
tggcctcagaaaccaggatctgcgacatttcctttttttggtgtacagccagtcattgtt
gatgagaaagggcgggaaatggaaggagaatgcagtggatatctttgcataaagaagtca
tggcctggggctttccggactctgtttggcgataaggacagatatgagacaacatacttc
aaaccattttctgggtattatttctctggtgatggttgtaggagggacaaagatggttac
cattggctgaccggaagagttgatgatgttatcaatgtcagtggacaccggattggtaca
gcagaggtcgagtcagctctggtttcacacccaaaatgtgctgaggccgctgttgttgga
attgaccatgaggtcaaaggtcagggaatctacgcatttgtgactttggttgatggtatt
ccttacagtgatgatctgcgcaaaagcctcgttatgacggtccgcagccagattggcgcg
tttgcagcacctgacaagatccattgggcaccaggactcccaaagacacggagcggcaag
atcatgcgaagaatattgcggaaaattgcctccaggcagctagatgagctcggtgacacc
agcacgcttgctgatcccggtgttgttgaccagctgatcacgcttagcgatacctag

DBGET integrated database retrieval system