KEGG   Brachypodium distachyon: 100827025Help
Entry
100827025         CDS       T01717                                 

Definition
acetyl-coenzyme A synthetase-like
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bdi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bdi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bdi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bdi00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 738 aa AA seqDB search
MAQYIYATATRHCCSPRVHPAIPLQVPAPLAPPSSRPLRVSPLRRRWAMGASDRLKVADA
RPRHAGPCAATMLGEPLPASDDHGLVHPSADFSAQALVSSPQQYQEMYQRSIDDPAGFWS
EIAETFYWKQKWSPDEVCTENLDVTKGPIKIEWFKGGKTNICYNAVDRHVEAGDGEKIAM
YWEGNEPDQDGKLTYSALLDKVCQLANYLKSVGVGKGDAVVIYLPMLMELPIAMLACARI
GAVHSVVFAGFSADALAQRITDCKPKVVITCNAVKRGPKLIPLKDIVDASLVQSAKNGVS
VGICLTYENQLAMKKENTRWITGTDVWWQDVVPNFPTRCDMEWVDAEDPLFLLYTSGSTG
KPKGVLHTTGGYMVYTASTFKHAFDYKPTDIYWCTADCGWITGHSYVTYGPLLNGAIVLL
YEGAPNYPNPGRCWDIVDKYGVTIFYTAPTLVRSLMRDGSEYVDQYSRKSLRVLGSVGEP
INPTAWRWFYNVVGNSRCPISDTWWQTETGGFMITPLPGAWPQKPGSATFPFFGVQPVIV
DEKGREMEGECSGYLCIKKSWPGAFRTLFGDKDRYETTYFKPFSGYYFSGDGCRRDKDGY
HWLTGRVDDVINVSGHRIGTAEVESALVSHPKCAEAAVVGIDHEVKGQGIYAFVTLVDGI
PYSDDLRKSLVMTVRSQIGAFAAPDKIHWAPGLPKTRSGKIMRRILRKIASRQLDELGDT
STLADPGVVDQLITLSDT
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatatatacgccaccgccacccgccactgctgctccccgcgcgtccacccc
gcgatcccgctccaggttcccgctcctctagccccgccgtcgtctcggccgcttcgggta
tcgccgctccggcggaggtgggccatgggcgccagcgatcgcctgaaggtggccgacgcc
aggccgcggcatgcggggccatgcgcggctaccatgctgggcgagccgctgccggcgtcc
gacgaccacggcctcgtccaccccagcgccgacttctccgcccaggccctcgtctcctct
ccgcagcagtaccaggagatgtaccagcggtctatcgatgatcctgcaggattctggtcg
gagatcgcagagacgttctactggaagcagaagtggagccctgatgaagtctgtaccgag
aaccttgatgtgacaaagggaccgatcaagatcgaatggtttaaagggggcaaaacaaac
atatgctacaatgccgtggaccgccatgtggaagctggagatggtgagaagattgcgatg
tattgggaggggaatgaacctgatcaggatggaaagctcacatactcagcactcttggat
aaggtttgccagctagcaaactacttgaaaagtgttggagttggaaaaggtgatgccgtg
gttatctacttgcctatgttgatggagctgcctattgcaatgcttgcctgtgcacgcatt
ggtgctgttcactctgttgtgtttgctggcttctctgctgatgcacttgcgcaaagaatc
actgactgcaagcctaaggttgtgattacatgcaatgcggtgaaaagggggccgaaactc
atccctctcaaagatatagtagatgcatctctggttcaaagtgcaaagaatggcgtctct
gtaggcatttgtttgacatatgaaaatcagttagccatgaagaaagagaacacacgatgg
ataacaggaacagatgtgtggtggcaggatgttgtgcccaatttcccaactagatgtgat
atggaatgggttgatgcagaggatccattgtttcttctatacacaagtggcagcacagga
aagccaaagggtgtattgcatacaactgggggctatatggtgtacactgcatcaacattt
aagcatgcatttgattacaagccaacagacatatactggtgcactgcagactgtggctgg
attactggacatagttatgtgacctatggtcctctcctgaatggagccatagttcttctt
tacgaaggggctccaaactaccctaatcctggtcggtgctgggacatcgttgacaaatac
ggggtgacaatattctataccgctccaacacttgtccgttcactcatgcgtgatggtagt
gagtatgttgaccagtactctcgtaaatctctaagagttctcggaagtgtgggtgagcca
ataaatcccactgcatggaggtggttctataatgttgtcgggaactcaagatgccccata
tcagacacttggtggcagactgaaactggtggttttatgattactcctttacctggtgct
tggcctcagaaaccaggatctgcgacatttcctttttttggtgtacagccagtcattgtt
gatgagaaagggcgggaaatggaaggagaatgcagtggatatctttgcataaagaagtca
tggcctggggctttccggactctgtttggcgataaggacagatatgagacaacatacttc
aaaccattttctgggtattatttctctggtgatggttgtaggagggacaaagatggttac
cattggctgaccggaagagttgatgatgttatcaatgtcagtggacaccggattggtaca
gcagaggtcgagtcagctctggtttcacacccaaaatgtgctgaggccgctgttgttgga
attgaccatgaggtcaaaggtcagggaatctacgcatttgtgactttggttgatggtatt
ccttacagtgatgatctgcgcaaaagcctcgttatgacggtccgcagccagattggcgcg
tttgcagcacctgacaagatccattgggcaccaggactcccaaagacacggagcggcaag
atcatgcgaagaatattgcggaaaattgcctccaggcagctagatgagctcggtgacacc
agcacgcttgctgatcccggtgttgttgaccagctgatcacgcttagcgatacctag

DBGET integrated database retrieval system