KEGG   Brachypodium distachyon: 100827073Help
Entry
100827073         CDS       T01717                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bdi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bdi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bdi00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bdi00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 330 aa AA seqDB search
MAASTSQHALISIKPAAPAASFSCGKRAGNARFVSATGCCPGSRKFGLVCAANSQSSVIE
PVHLPSSPESGSTPKKSGESALILIRHGESLWNEKNLFTGCVDVPLTPKGVNEAIEAGKR
ICNIPVDVIYTSSLIRAQMTAMLAMMQHRRKKVPIIVHSESERAHQWSQVYSEETKKQSI
PVVTAWQLNERMYGELQGLNKQETADRFGKDQVHEWRRSYDIPPPNGESLEMCAERAVSY
FKDQIVPQLVAGKHVMIAAHGNSLRSIIMHLDKLTSQEVISLELSTGIPMLYIFKEGKFI
RRGSPAGPSEAGVYAYTKKLAQYRQKLDGM
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtccacatctcagcatgcgcttatctccatcaaacctgctgcccctgctgcc
agcttcagctgtggtaagagagccggcaatgcgcgttttgtttcggcgacgggttgctgc
cccggtagccggaaattcggtttggtttgcgcggcgaactcgcagtcttcggtaatcgag
ccggtccacctgccgtcgagccccgaaagcggcagcaccccgaagaaatcaggtgaaagt
gcgcttatattgattcggcatggggaatcgttgtggaatgagaaaaatctgtttactggc
tgcgttgatgtgcccctgacccccaagggtgtcaacgaagcaatcgaggccggtaaaagg
atatgcaatatccctgttgatgtaatatacacttcgtcactgattcgtgctcagatgacc
gctatgcttgccatgatgcagcatcgtcgtaagaaggttccaattattgtgcacagcgag
agcgaacgggcacaccagtggagtcaggtatacagcgaagagacaaagaagcagtccatc
cctgtcgtaacagcttggcagttgaatgagcgaatgtatggtgaacttcaaggccttaac
aagcaagaaacggctgatcggtttggcaaagaccaagttcatgaatggcgtcgcagttat
gacattcctcccccaaatggcgagagcctggagatgtgtgcagagagagcggtttcttat
ttcaaagatcaaattgtacctcagcttgtggctggaaagcatgttatgattgctgcccat
gggaattcacttcgttcaattatcatgcatctggacaagttgacttctcaagaggtaatc
agccttgagttgtctactggcattcctatgctgtatatatttaaggaggggaaatttatc
aggcggggcagtccagcaggaccttctgaggcaggagtctatgcttataccaagaaattg
gctcagtacagacagaagcttgatggcatgtaa

DBGET integrated database retrieval system