KEGG   Brachypodium distachyon: 100827373Help
Entry
100827373         CDS       T01717                                 

Definition
AMSH-like ubiquitin thiolesterase 3-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100827373
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100827373
Peptidases [BR:bdi01002]
 Metallo Peptidases
  Family M67
   100827373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 516 aa AA seqDB search
MGPPRPARGVISIEACARPIAVDHRIRLPYYFRIAGSLLRQAKIYRDEKNILDLYVILLR
YTSLLCETIPKHRDYPVFKSREAEFLRNANSATLIDVVNELESLKPVVKRQIAEYNRGGS
VEANGLNGTHTISQRTEQHPRTTYSTQPLVGSNSGSLEKFIPGGRHQATSLPSVQTDRQI
RKQFANLPFPKEETLARHSILGPNGLQGQWTGPVTAIKVQYPSNLEFTQSDMTSLVPVML
NQDVLHGSSTMYPDSTTKDNDDMKNVLSLDDGRWSAPAEECTSVPSVSLDGELSQLNIRQ
PSPPPVLAEVHPERRPISPSRIADPTPGLAISETGRYQNLHVPVKLMECFLRVAESNTKR
SLETCGVLAGTLKKRTFYVTTLIIPKQKSTSDSCEATNEEELFEVQDTGSLFTLGWIHTH
PTQSCFLSSIDLHNHYSYQVMLPEAIAIVMAPTDTRKKHGIFHLTDPGGIGVIQDCPERG
FHPHKAPLDGSPIYEHCSHVYMNADTKFDMIDLRER
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggggccaccaagaccagccaggggagtcatcagcatcgaggcgtgcgcgcggccgatc
gccgtcgaccaccgcatcaggctcccctactacttccgcatcgcgggctccctcctccgc
caggccaagatatatcgggatgagaagaacatcctcgacttgtatgtcatcctcctgaga
tacacgagcttgctgtgcgagacgatcccgaagcaccgtgactaccctgtgttcaagtcg
agagaagctgagttcttgaggaatgctaactccgccacactcattgatgttgtcaatgag
cttgagtctctgaagccagttgtgaagcggcagatcgctgagtataacagaggaggttct
gttgaagctaatggtctaaatggaacccacaccataagtcaaaggacagagcagcatcct
cgaaccacatattccactcagccacttgtaggaagcaacagtggatcattggaaaaattc
atcccaggtggaagacatcaagcgacatcattaccgagtgtccaaactgataggcagatt
cgcaaacaatttgcaaatctgccttttccaaaagaagaaacactagctagacactccata
ttaggacctaatgggctccaaggacaatggactgggcctgttacggcaatcaaggtccaa
tatccaagcaatcttgaatttacacaaagcgatatgacaagtttagtgccagttatgttg
aaccaagatgttctgcatggttccagtaccatgtatccggatagcactacaaaggataat
gatgatatgaaaaatgttctgtctcttgatgatggtcgatggtctgcaccagcagaagaa
tgcacctctgtgccttctgttagtctggacggagaactgtcacaattgaatatcagacaa
ccttcacccccgccagtcctggcagaggtgcatcctgagcgtagaccaatttctccatcg
agaattgctgatccaacaccaggacttgctatatcagagaccggccgttatcagaacttg
catgttccggtgaagttgatggagtgttttctaagggttgccgagtcaaacaccaaaaga
agtttagaaacatgtggggttcttgctggtaccctgaagaagagaactttttatgtcaca
accttaataattccaaagcagaaatctacatctgattcatgtgaagccacaaatgaagaa
gaactattcgaagttcaggacaccggctcacttttcactcttggttggatccatacacat
ccaacacagtcctgtttcctctcttccattgatctccataatcattattcgtatcaggtc
atgctaccggaggcaattgcgatagttatggcacctaccgacacaagaaaaaaacatggt
atatttcatctaacggatccaggcggcatcggtgtgatccaagattgcccagagagaggt
ttccatccgcacaaggcacctctagacggctcaccaatctatgagcattgctcccatgtg
tacatgaatgccgatacgaagtttgatatgattgatctcagagagcggtga

DBGET integrated database retrieval system