KEGG   Brachypodium distachyon: 100827737Help
Entry
100827737         CDS       T01717                                 

Definition
uncharacterized LOC100827737
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bdi  Brachypodium distachyon
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bdi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 480 aa AA seqDB search
MGALEEAHLAAAAIVACGCEDDDEEEDLAQLDEALPGDAMEPAVRALLVGLGEDERREGL
RRTPKRVAKAFRDGTRGYRQKVKDIVQGALFPEVGVDKRTGSAGGTGGQVVVRDIDLFSY
CELCLLPFSIQCHVGYVPSGGRVVGLSKLSRVADVFAKRFQSPQRLANEVCGALHASIQP
AGVAVTLQCWHIPLPENLKCKSSQGWIRTSHSSRSGVFEGEDSSFWNDFVALLKLKGIDM
EMDNHSSFLPWCPLRPHEVLVCNGHSKRTTTNGVISPKSVSTPSNMVSSVSTMLLSLGED
PLRKELLGSPQRYVQWLMRFRACNLDVKLNGFTLNSAGVYERPDEDASDHRAISSELHLP
FCAQCEHHLLPFYGVVHIGYFGSGDGEGDRSHFHALVQFYGCKLQVQERMTRQIAEAVYS
VSHRGAIVVVEANHICMISRGIEKIRSSTATIAVLGDFLTDSSVKACFLQKVLDTVGLEA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgctcgaggaggcgcacctggccgccgccgccatcgtcgcgtgcgggtgcgaa
gacgacgacgaggaggaggatctggcgcagcttgatgaggcgctgccgggggacgccatg
gagccggcagtgcgcgcgctgctggtggggctcggcgaggacgagcgccgggaggggctg
cgcaggacgcccaagcgcgtcgccaaggccttccgcgacggcacccgaggttacagacag
aaagtaaaagacattgtgcagggtgctctgtttcctgaggttggtgttgacaaaaggact
ggttctgctggaggaactggagggcaagttgttgtccgtgatatcgatcttttctcatac
tgtgagttgtgcttgcttccattcagcatacagtgccatgttgggtatgtgccctctggt
ggaagggttgttgggttaagcaagctttcgagagtagcggacgtctttgccaagaggttt
caaagccctcagagattagctaatgaagtttgtggtgcattgcatgctagcatacagcct
gctggtgtggctgttactctgcagtgctggcacataccattgccagagaacctgaaatgc
aagagttctcagggttggattagaacttcacattcatctcgttctggagtttttgagggt
gaggacagctctttttggaatgactttgtggctcttcttaagctcaaaggcatagacatg
gagatggacaaccattcttcatttctaccttggtgccccttaaggcctcatgaggttctg
gtctgcaatgggcacagcaagaggaccacaaccaatggtgtaatttcaccaaaatctgta
tccactccctctaatatggtttcttctgttagcacaatgctcctgtctcttggagaggac
cccctcaggaaagaacttctaggcagtcctcagcgttacgtgcaatggctgatgaggttc
agagcatgtaatctcgatgtgaagctgaatggttttacactcaacagtgcaggtgtatat
gagagaccagacgaagatgctagtgatcatcgagcaatcagttctgagctgcatttgcca
ttttgtgcccagtgcgagcaccacctcctgccattctatggggtagtgcacattggttac
tttggcagtggggacggtgaaggtgatcgctcccatttccatgctctggttcagttctac
ggatgcaagcttcaagttcaagaaaggatgacaagacagatagctgaggcggtgtattct
gtttcacatcgtggagccatagttgttgtagaagccaatcacatttgcatgatatcaagg
ggaattgagaaaatcaggagtagtacagcaactattgcagttttgggggattttttgacc
gactcttctgtcaaggcttgctttctacaaaaagttttagatactgttggtctggaagca
tga

DBGET integrated database retrieval system