KEGG   Brachypodium distachyon: 100827794Help
Entry
100827794         CDS       T01717                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00071  Fatty acid degradation
bdi00592  alpha-Linolenic acid metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01212  Fatty acid metabolism
Module
bdi_M00087  beta-Oxidation
bdi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    100827794
   00592 alpha-Linolenic acid metabolism
    100827794
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100827794
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100827794
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100827794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 100827794
NCBI-ProteinID: XP_003572416
UniProt: I1HZH4
Position
3
AA seq 726 aa AA seqDB search
MAGSIRVTMEVGADGVALITICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAAG
KFCGGFDINVFTKVHETGDVTLMPDVSVELVSNMMEEGKKPSVAAIQGLALGGGLELTMG
CHARISTPEAQLGLPELTLGVIPGFGGTQRLPRLVGLPKAIEMMLQSKFITAKEGKERGF
VDALCSPDELIKLSRFWALEIANCRKPWIRSLGRTDRLGSLSEARAVLNMAREQAKKVAL
NMPQHQACLDVIEEGVVFGGHAGVVKEAKVFKELVLSTTSKALVHVFFAQRSTTKVPGVT
DIQIKPRQIKKVAVIGGGLMGSGIATALLVGNISVVLKEVNPQFLKRGQNTIAGNLEGLV
KRGSLTKDKMNKAISLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFADIEKICPPHCIL
ATNTSTIDLNVVGEKTKSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQAILDLITVGKII
KKVPVVVGNCTGFAVNRTFFPYTQGSQLLVSLGIDLFRIDRVISSFGMPLGPFQLQDVAG
YGVALAVKDIYAAAFGTRNFDSDLVVLMAEDGRQGKINGKGYYLYEKGGKPKPDPSVQHV
IDEYRKRAKTMPDGKPVTLSDQDILEMVFFPVVNEACRVMDENVVIRASDLDIASVLGMG
FPKYRGGLIFWADTVGASYIYSKLTKWAELYGDFFKPSLYLEDRAKSGRLLGAPRMSQQS
SSRSRM
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtcgatccgcgtcaccatggaggtcggcgccgacggcgtcgcgctcatcacc
atctgcaacccgcccgtcaatgcgctgcaccccatcatcatccaggggctcaaggagaag
tacgccgaggccatggatcgcgacgacgtcaaggccatcgtgctcactggtgctgcgggc
aagttttgtgggggctttgatattaatgttttcacaaaagttcatgagactggagatgtg
acacttatgcctgatgtgtctgttgagcttgtgtcaaatatgatggaagagggcaaaaaa
ccttctgttgctgccattcaaggccttgctctcggtggaggactagagttgactatgggt
tgtcatgctcggatatctacacctgaagctcaacttggattaccagagctaactctcggc
gtgatacctggatttggaggaacccagcgtctgccaaggcttgtaggcctgcccaaagca
atagaaatgatgctgcaatcaaagttcattacagcaaaggaagggaaagaacgtggtttt
gttgatgcgctttgctcccctgacgagttgataaaattgtcacgcttttgggctctggag
attgctaattgccgtaaaccttggataagatcgcttggcagaacggataggcttggctca
ctgtctgaagctcgtgctgtgttaaatatggcaagagaacaagcaaagaaggttgcgcta
aacatgccacagcaccaagcatgcttagatgttattgaagaaggtgtagtgtttggaggc
catgctggtgttgtaaaggaagccaaggttttcaaggagttggtactatcaacaacatca
aaggcacttgtccatgtattttttgcgcaacgttccaccacaaaggtgcctggtgttact
gatattcaaataaaacctaggcaaataaaaaaagttgctgttattggcggtggtcttatg
ggctctggaattgcaacagcacttctagttggcaatatatctgttgtcctgaaggaagta
aaccctcaatttctgaaaaggggacaaaatacaatagcaggaaatcttgagggcctagtc
aaaagaggctcattgacaaaggataagatgaacaaggccatatcacttctcaagggtgcg
ttggattattcagatttcaaggatgttgatatggttattgaggctgttatagagaagatt
cctttgaagcaatcaatatttgctgacattgagaaaatctgcccgccacattgcatactt
gcaacgaacacatccaccatcgatttgaatgttgttggcgagaagacaaaatctcaagat
agaattataggggcacattttttcagccctgctcatattatgcctttacttgaaattgtc
cgtacggagaagacatcgccacaagctatccttgatctcatcacagttgggaaaataata
aagaaagttcctgttgtggttggcaactgcacgggctttgcagtaaaccgtacatttttc
ccttacacacagggttctcagcttctagtcagtcttggcattgatcttttcagaattgac
cgagtaataagcagctttggcatgcctctgggacctttccaactccaggatgtagctgga
tatggagtagccttggcagtgaaagatatctatgcagctgctttcggaacacggaatttt
gattctgatctagtggttttgatggcagaggatgggcgacaaggaaagatcaatggaaaa
ggttattacctttatgagaagggtgggaagccaaagccagaccctagtgttcaacatgtg
attgacgaatacagaaaacgagcaaagacaatgccagacggaaagcctgttactttatcg
gatcaagatatattggagatggttttcttcccggtagttaacgaggcatgcagggtcatg
gatgaaaatgttgtgatcagggcttctgatcttgatattgcatctgtccttgggatgggc
tttccgaagtacaggggtggcctcatcttctgggctgacactgttggagcatcttatata
tattcaaagcttacaaagtgggctgagctttatggtgatttcttcaagccatcattatat
ttggaagacagagcaaaaagtggccgcctgctgggcgcgccacgcatgtctcaacaatct
tcgtcaaggtcacgcatgtga

DBGET integrated database retrieval system