KEGG   Brachypodium distachyon: 100827799Help
Entry
100827799         CDS       T01717                                 

Definition
aspartate carbamoyltransferase 2, chloroplastic-like
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bdi  Brachypodium distachyon
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100827799
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100827799
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     100827799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 354 aa AA seqDB search
MAAARATLPHPHLPAPSWRTQLKPVPRRVVAASAAPSPALTASLRLGDVIEAQQFDRQAL
NEIFEVAREMEAVERGSHGSRSRVLEGYLMATLFYEPSTRTRLSFEAAMRRLGGEVLTTE
NAREFSSAAKGETLEDTIRTVEGYSDIIVLRHFESGAARRAAVTANIPVINAGDGPGQHP
TQALLDVYTIKREIGRLDGIKLGLVGDLANGRTVRSLAYLIAKYQNIKIYFVSPDVVKMK
DDIKEYLTSQGVEWEESSDLLEVASKCDVIYQTRIQKERFGERIDHYEAARGKYIVDRKV
LGVLPKHAVIMHPLPRLDEITVDVDSDPRAAYFRQAKNGLYIRMALLKLLLVGR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcccgggccacgctccctcatccccacctccccgccccctcatggagaacc
cagctcaagcccgtcccgcgccgcgtggtcgccgcctccgccgcgccgtcgccggcgctc
acggcgtccctgcggctcggcgacgtgatcgaggcgcagcagttcgaccggcaggcgctc
aacgagatcttcgaggtggcgcgggagatggaggccgtggagcggggctctcacgggtcc
cggagccgcgtcctcgaggggtacctcatggccacgctcttctacgagccctccacccgc
acgcgcctctccttcgaggccgccatgcgccggctcggcggggaggtgctcactactgag
aacgcccgcgagttctcgtccgccgccaagggcgagaccctcgaagataccataaggacc
gttgaaggttattcggatattattgttcttagacattttgaaagtggggctgcaaggaga
gcagctgttactgcaaacattccagttatcaatgcaggtgatgggccagggcaacatcca
actcaggctctgttggatgtatatacaataaagagagagattggtaggctagatggaata
aagcttggtttggttggggaccttgctaatgggagaacagttcgctctcttgcctatttg
attgctaaataccagaacattaagatatattttgtatctccagatgttgtaaaaatgaag
gatgacatcaaagagtacttaacttcacaaggtgttgaatgggaggaaagttcagatttg
ttggaggtggcatccaagtgtgatgttatttaccaaacacgcattcaaaaagaaagattt
ggtgagaggatcgaccactatgaagctgctcgtggtaaatacattgtggacagaaaggtt
ttaggtgtgctgccgaagcatgctgttatcatgcatccacttccaaggcttgatgagatc
acagtagatgttgacagcgatccaagggctgcatattttaggcaggctaagaatggcctc
tacatacggatggcactgctcaaacttctgcttgttggtcgttga

DBGET integrated database retrieval system