KEGG   Brachypodium distachyon: 100827802Help
Entry
100827802         CDS       T01717                                 

Definition
beta-amylase 3, chloroplastic-like
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
bdi  Brachypodium distachyon
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100827802
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     100827802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 548 aa AA seqDB search
MALTLRSSTSFLSPLEPSSKLHKAEDAPPSCVAVPAAPSRLRVLRAAAQAPLSPMEAPAP
ELLHGQAQQAHSGGQKRGGVPVYVMLPLDTVGPGGQLLRARALAASLMALRSAGVEGVMV
DVWWGVVEREGPGRYDWEGYAELVRMVERAGLRLQMVMSFHQCGGNVGDSCNIPLPSWVL
EEVSANPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPVQVYSDFMRSFRDRFSGYLGTV
IAEIQVGLGPCGELRYPSYPEANGTWSFPGIGEFQCYDKYMRASLQAAAAAAGHENWGTN
GPHDAGEYKQFPEETGFFRWDGTWSTEYGSFFLEWYSGMLLEHGDRVLAAAEAVFGGTGA
MLSAKVAGIHWHYRTRSHAAELTAGYYNTRNHDGYAPIAGMLAKRGVVLNFTCMEMKDEQ
QPGHAGCSPEQLVRQVRAAARAANVELAGENALERYDESAFAQVAATAAAGDAGAGLSAF
TYLRMNRNLFDGDNWRRFVAFVKTMADGGGARTGLPSCDTGHSDLYVGFLEAANERRAPE
AEAAAAAL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgacgctgaggtcctcgacgtcttttctctcgccgctcgaaccctcctccaag
ctccacaaggccgaggacgcgccgcccagctgcgtcgcggtccccgccgcgccgtccagg
ctgcgggtcctcagggcggctgcgcaggcccctctgtcgcccatggaggctccggcgccc
gagctgctgcacggccaggcccaacaggcccactccggtggccagaagcgcggcggggtt
cccgtgtacgtgatgctgccgctggacacggtggggcccggcgggcagctgctgcgggcg
cgcgccctggcggcgagtctgatggcgctgcggagcgccggggtggagggggtcatggtg
gacgtctggtggggcgtcgtggagagggagggccccggccggtacgactgggaggggtac
gccgagctcgtgcgcatggtggagcgcgccggcctccgcctccagatggtcatgtccttc
caccagtgcggcggcaacgtcggagactcctgcaatatcccgttgccttcatgggtactg
gaggaggtgagcgccaacccggacatcgtgtacacggacaggtccgggcggcggaacccg
gagtacatctccctcggctgcgacacgctgccggtgctcaagggccggaccccggtccag
gtctactccgacttcatgcgcagcttccgcgacaggttcagcggctacctcggcaccgtc
atcgccgagatccaggtcggcctgggtccttgcggggagctcaggtatccttcctacccg
gaggccaatggcacctggagtttcccgggcatcggcgagttccagtgctacgacaagtac
atgcgggcgtcgctgcaagcggcggcggctgctgcggggcacgagaactgggggacgaac
gggccgcacgacgccggcgagtacaagcagttccctgaggagacgggcttcttccgttgg
gacggcacgtggagcaccgagtacggcagcttcttcctcgagtggtactccgggatgctc
ctggagcacggcgaccgcgtcctggccgcggccgaggccgtcttcggcggcacgggcgcc
atgctctccgccaaggtcgccggcatccactggcactaccgaacccgctcccacgccgcc
gagctcacggcggggtactacaacacccggaaccacgacgggtacgcgccgatcgccggg
atgcttgccaagcgcggcgtcgtgctcaacttcacgtgcatggagatgaaggacgagcag
cagccggggcacgccgggtgctcgccggagcaactggtgcggcaggtcagggcggccgcg
cgggcggccaacgtggagctcgccggcgagaacgcgctggagcggtacgacgagtccgcg
ttcgcgcaggtcgccgccacggccgcggccggcgacgccggcgccgggctgagcgcgttc
acgtacctgcgcatgaacaggaacctgttcgacggtgacaactggcgccggttcgtggcg
ttcgtgaagaccatggcggacggcggcggcgcgaggacggggctgccgagttgcgacacg
gggcactcggacctgtacgtcgggttcctcgaggccgccaacgagaggagagcgccggag
gcagaggccgccgccgccgcattgtag

DBGET integrated database retrieval system