KEGG   Brachypodium distachyon: 100827851Help
Entry
100827851         CDS       T01717                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
bdi  Brachypodium distachyon
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100827851
  Replication and repair
   03420 Nucleotide excision repair
    100827851
Transcription machinery [BR:bdi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100827851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 451 aa AA seqDB search
MPQVMVVARNFMDMVAALPAAKLDMLYDSAFICEAVLRSFPPLAKKYALQMLYVSAPMPA
AAMEEWVLDEYASKHKVAIDRLLQLRVFVEVRDRRKEVSYKMNDKFQGNMQKYLVDGGSL
PREPISSSVTGRLPTLTELENYALEQWECFLLQLINSSQVERGTSFSSSMMKTFQRGLLS
SRDGDAPKLSENGFQFLLMETNAQLWYIMREYISSAEERGVDPTELISFLLELSFHTLGA
AYSFNTLTDVQRIAIRDLAELGLVKVQQGRKDSWFIPTKLATNLSSSLSDSSASKEGIVV
VETNFRLYAYSASRLHCEILRLFSRVEYQLPNLIVGAITKESLYGAFDNGITAEQIISFL
KQNAHPRVADKIPVVPENVTDQIRLWETDRNRVDMVLSHVYEDFPSKDMFEQCCDLARDN
GFLLWEDSKKMRLIVRVEFHQEMREFLRRQR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggtgatggtggtcgcgcggaacttcatggacatggtggccgcgctgcctgct
gccaaactcgacatgctctatgattccgccttcatctgtgaggctgtgctcaggtcgttc
ccaccgctagcaaagaagtacgcgcttcagatgttgtacgtgtcagcaccgatgcccgct
gcggctatggaggagtgggtgctggatgagtatgcctccaaacacaaggttgccatcgat
aggctgctccaacttagggtctttgtcgaagtacgtgatagaagaaaagaggtgagctac
aagatgaatgataagttccaggggaacatgcagaagtatttggttgacggtggaagttta
ccaagggaaccgatatcatcaagtgtcactggcagattgcccacactaacagaactagaa
aactacgcccttgagcaatgggagtgctttttgctgcaattaataaattcatctcaagtt
gagagagggacaagtttcagctcgtctatgatgaaaacatttcagcgaggtcttctgagt
tcaagggatggcgatgctccaaagttaagtgagaatggcttccagtttctgctgatggag
acaaatgcgcaactttggtacataatgcgagaatacatttcatcagcagaggaacgtgga
gtagaccctacggagttgatctcatttctcttggaacttagttttcatacactgggagcg
gcttatagcttcaatactctgactgatgtccaaagaattgctattagagatctggcggag
ctggggttagtcaaagtgcagcagggacggaaagatagctggttcatacctacaaaattg
gccacaaacctctcatcgagcttgtcagattcttctgccagcaaagagggtattgtggtt
gtggagacaaactttaggttatatgcatactctgcttccagattgcactgtgaaattcta
cgccttttttcaagggtggagtatcaacttccaaacctcatcgtgggagctattacaaaa
gaaagtctttatggtgcttttgacaatgggatcactgctgaacagataatttcattcctt
aagcaaaacgcccacccccgcgttgccgacaaaatacctgttgtgccagagaatgtgaca
gatcagattaggttgtgggagaccgatcgaaacagggttgacatggtcctgtcacatgta
tacgaagattttccgagcaaggacatgtttgagcaatgctgtgatcttgcaagggataac
ggtttcttgctctgggaggactcaaagaagatgagattgatagtacgagtagagttccac
caagagatgcgggagttcctccgcaggcaaagatga

DBGET integrated database retrieval system