KEGG   Brachypodium distachyon: 100827851Help
Entry
100827851         CDS       T01717                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
bdi  Brachypodium distachyon
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:bdi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bdi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 451 aa AA seqDB search
MPQVMVVARNFMDMVAALPAAKLDMLYDSAFICEAVLRSFPPLAKKYALQMLYVSAPMPA
AAMEEWVLDEYASKHKVAIDRLLQLRVFVEVRDRRKEVSYKMNDKFQGNMQKYLVDGGSL
PREPISSSVTGRLPTLTELENYALEQWECFLLQLINSSQVERGTSFSSSMMKTFQRGLLS
SRDGDAPKLSENGFQFLLMETNAQLWYIMREYISSAEERGVDPTELISFLLELSFHTLGA
AYSFNTLTDVQRIAIRDLAELGLVKVQQGRKDSWFIPTKLATNLSSSLSDSSASKEGIVV
VETNFRLYAYSASRLHCEILRLFSRVEYQLPNLIVGAITKESLYGAFDNGITAEQIISFL
KQNAHPRVADKIPVVPENVTDQIRLWETDRNRVDMVLSHVYEDFPSKDMFEQCCDLARDN
GFLLWEDSKKMRLIVRVEFHQEMREFLRRQR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggtgatggtggtcgcgcggaacttcatggacatggtggccgcgctgcctgct
gccaaactcgacatgctctatgattccgccttcatctgtgaggctgtgctcaggtcgttc
ccaccgctagcaaagaagtacgcgcttcagatgttgtacgtgtcagcaccgatgcccgct
gcggctatggaggagtgggtgctggatgagtatgcctccaaacacaaggttgccatcgat
aggctgctccaacttagggtctttgtcgaagtacgtgatagaagaaaagaggtgagctac
aagatgaatgataagttccaggggaacatgcagaagtatttggttgacggtggaagttta
ccaagggaaccgatatcatcaagtgtcactggcagattgcccacactaacagaactagaa
aactacgcccttgagcaatgggagtgctttttgctgcaattaataaattcatctcaagtt
gagagagggacaagtttcagctcgtctatgatgaaaacatttcagcgaggtcttctgagt
tcaagggatggcgatgctccaaagttaagtgagaatggcttccagtttctgctgatggag
acaaatgcgcaactttggtacataatgcgagaatacatttcatcagcagaggaacgtgga
gtagaccctacggagttgatctcatttctcttggaacttagttttcatacactgggagcg
gcttatagcttcaatactctgactgatgtccaaagaattgctattagagatctggcggag
ctggggttagtcaaagtgcagcagggacggaaagatagctggttcatacctacaaaattg
gccacaaacctctcatcgagcttgtcagattcttctgccagcaaagagggtattgtggtt
gtggagacaaactttaggttatatgcatactctgcttccagattgcactgtgaaattcta
cgccttttttcaagggtggagtatcaacttccaaacctcatcgtgggagctattacaaaa
gaaagtctttatggtgcttttgacaatgggatcactgctgaacagataatttcattcctt
aagcaaaacgcccacccccgcgttgccgacaaaatacctgttgtgccagagaatgtgaca
gatcagattaggttgtgggagaccgatcgaaacagggttgacatggtcctgtcacatgta
tacgaagattttccgagcaaggacatgtttgagcaatgctgtgatcttgcaagggataac
ggtttcttgctctgggaggactcaaagaagatgagattgatagtacgagtagagttccac
caagagatgcgggagttcctccgcaggcaaagatga

DBGET integrated database retrieval system