KEGG   Brachypodium distachyon: 100828384Help
Entry
100828384         CDS       T01717                                 

Definition
beta-galactosidase 8-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
bdi  Brachypodium distachyon
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100828384
  Lipid metabolism
   00600 Sphingolipid metabolism
    100828384
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100828384
   00604 Glycosphingolipid biosynthesis - ganglio series
    100828384
   00511 Other glycan degradation
    100828384
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100828384
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100828384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 674 aa AA seqDB search
MASGRSFLDLCLLALSLCSALASTVDGGASRRFWIEGDAFRKDGERFQIVGGDVHYFRIV
PEYWKDRLLRAKALGLNTVQTYVPWNLHEPEPQSWEFNGFADIESYLRLAHELEMLVMLR
VGPYICGEWDLGGFPPWLLTIEPALKLRSSDSAYLSLVERWWKVLLPKVAPLLYSNGGPI
IMVQIENEFGSFGDDKNYLHYLVLLARRYLGNDIILYTTDGGTIGTLKNGSIHQDDVFAA
VDFSTGDDPWPIFRLQKEYNFPGKSAPLTAEFYTGWLTHWGESIATTDASSTAKALKSIL
CRNGSAVLYMAHGGTNFGFYNGANTGQNESAYKADLTSYDYDAPIKEHGDVHNPKYKALR
SVIHECTGTPLHPLPANIERSNYGLVKLQKVASLFDIFDKIGDPLKVSVSEQPLSMEQTG
QMFGFLLYSSEYEGKGPYSILSIPKVHDRAQVFVSCSLDGVRNRRYAGIIERWSKKTLQI
PSLSCSSKTSLYILVENMGRVNYGPYIFDLKGILSSVEIDGVTVRHWKMYPLSFDALGEL
SKFQPIQQITDARASKVPIHGYLQSKFRDSSFYQNVGISEGPEFYEGHFVIGSENAIKDT
FISFRGWNKGVAFVNNFNIGRFWPAMGPQCALYVPAPILKSGDNVVVIFELHSPNPEHTI
NLVKDPDFTCGPNQ
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccggtagaagcttccttgatctctgcctcctcgcgctgtcgctctgctccgcg
ctcgcctccacggtcgatggcggggcttcgagaaggttctggatcgagggcgacgccttc
cggaaggacggggagcggttccagatcgtcggcggcgacgtgcactacttccgcattgtt
cccgagtactggaaagaccgcctgctaagggctaaggcactaggcttgaacacggttcaa
acatatgttccttggaatttgcatgagccggaaccgcagagctgggaattcaatggattt
gccgacattgaatcgtacctaagacttgctcatgaattagagatgctggtcatgcttcgt
gtcggtccatatatttgtggagaatgggacttagggggatttccaccttggttgctcacc
atagaaccagcccttaaactgcgatcatcagattcagcctatctttccttggtcgagaga
tggtggaaagtattacttccaaaagtggcaccactattatacagcaatggaggtccaatt
atcatggtgcagattgaaaatgaatttgggtcatttggagatgacaagaattacctccat
taccttgttctactagccagacgatatctggggaatgacattattctgtatacaactgat
gggggcaccattgggaccttaaagaatggatcaattcatcaagatgatgtttttgctgct
gttgatttttctacgggcgatgatccatggccaatattcagattacagaaggaatacaac
tttccaggaaaatcagcccctttaaccgcggaattttataccggatggctaacacactgg
ggtgaaagtattgcaacaacagatgctagcagcacagctaaagctcttaaaagtattttg
tgccgcaacggttctgctgtactttatatggctcatggtgggaccaattttgggttttac
aatggggcaaatactggccaaaatgagtccgcgtacaaagctgacctcacttcttatgat
tatgatgcgcctattaaggagcacggggacgtgcataatccaaaatacaaagcactgaga
agtgtaatacatgaatgcactggcactcctcttcatcctcttcctgccaacattgaaaga
tcaaattatgggctcgtgaaactacaaaaggttgcttctttgtttgacatatttgataag
ataggtgatcctctgaaagtgtctgtctcagagcagcctctgtccatggaacagacaggc
cagatgtttgggtttctactttactcctcggaatacgaagggaaaggtccttacagcatc
ctatcaattccaaaggtacatgacagagcccaggtttttgtgtcctgctcacttgatggt
gtcagaaatcgaagatatgctggcattattgaaagatggtctaagaaaaccctacagata
ccgagcttgagctgctcatctaagaccagcttatatatcctggtagaaaatatgggccgc
gtaaattatgggccatatatttttgacctgaaggggatattatcttctgttgaaatagat
ggtgttactgtccgtcactggaaaatgtatcctctatcatttgatgcactaggcgagctt
tcaaaattccaaccaatacagcagatcactgatgccagagctagcaaagtgcccattcat
ggttatttacaaagcaagtttcgtgattcgtcattctatcaaaatgtaggtatttcagaa
ggaccagagttttatgaaggccatttcgttattggctccgagaatgcaataaaggataca
ttcatatcatttcgtggttggaacaaaggggtcgcttttgtgaacaacttcaacatcgga
aggttctggccggcaatgggaccacaatgtgctctttatgttcctgcgccgatcctcaaa
tctggagacaacgttgttgttatctttgaactgcatagtcccaatcctgagcatactatc
aacttggtaaaagatccggatttcacatgtggtccaaatcaatga

DBGET integrated database retrieval system