KEGG   Brachypodium distachyon: 100828728Help
Entry
100828728         CDS       T01717                                 

Definition
(RefSeq) histone H2B.2
  KO
K11252  histone H2B
Organism
bdi  Brachypodium distachyon
Brite
Chromosome and associated proteins [BR:bdi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100828728
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100828728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF CCSAP Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 100828728
NCBI-ProteinID: XP_014757906
UniProt: I1IT46
Position
4
AA seq 293 aa AA seqDB search
MAPKRRVKKVVSSVVRKKTTKVVQETVQVSTAILPDDSAQPEPEVVVDVSTPATVVKHVE
VTSDVGDDQATAAGATAVNNKPPQSKSPDKPADDNQATAPAVPSLQSQETQTQDPNEKKK
TPQQEIVVVTTKGPPGLEPEEKTKKLQPDAPETPKQAGGAGTGGKDEAAAPKKKKKKKKK
KRKARRGGGRRRGPVGDMGMMGGGYKRYVYRVLKQVHPDMGASGRAMEVLDMMMGDMFER
LADEAARLAKVAGRATLSSREVQNAVRLVLPGELAKHAISEGTKAVTSYMSLA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaagcgacgcgttaagaaggtggtgagctccgtggtgaggaagaagaccacc
aaggtggtgcaggagaccgtccaggtctccaccgccattctccccgacgactccgcccag
ccggagccggaggtcgtcgtcgacgtctccacccccgccaccgtcgtcaagcacgtggag
gtcacctccgacgtcggagacgaccaagccaccgccgccggcgccaccgccgtcaacaac
aagcctccacagtccaaatccccagacaagcctgccgatgacaatcaggcgacagcgccg
gctgtgccgtcgctgcagagccaggagacgcagacgcaggaccccaacgagaagaagaag
acgccgcaacaggagatcgtcgtggtgactaccaaagggccgccggggctggagccggag
gagaagaccaagaagctgcaaccagacgcgcccgagacgcccaagcaagcaggcggcgcc
gggaccggcggcaaagacgaggctgcggcgccgaagaagaagaagaaaaagaagaagaag
aagaggaaggcgagaaggggcggcggacggcggcgggggccggtgggggacatggggatg
atggggggagggtacaagaggtacgtgtacagggtgctgaagcaggtgcacccggacatg
ggcgcgtccgggcgggccatggaggtgctggacatgatgatgggggacatgttcgagcgc
ctggcggacgaggcggcgcgcctcgccaaggtcgccggacgcgccacgctctcctcacgc
gaggtgcagaacgccgtcaggctcgtcttgcccggggagctcgccaagcacgccatctcc
gagggcaccaaggctgttaccagctacatgtccctcgcttag

DBGET integrated database retrieval system