KEGG   Brachypodium distachyon: 100829292Help
Entry
100829292         CDS       T01717                                 

Definition
(RefSeq) histone H2B.1
  KO
K11252  histone H2B
Organism
bdi  Brachypodium distachyon
Brite
Chromosome and associated proteins [BR:bdi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100829292
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100829292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa RP-C Activator-TraM GAGE
Motif
Other DBs
NCBI-GeneID: 100829292
NCBI-ProteinID: XP_003568603
UniProt: I1HK56
Position
2
AA seq 153 aa AA seqDB search
MAPKAEKKPAAKKPVEEEPAAEKAEKAPAGKKPKAEKRLPAGKTASKEGGGEKRGRKKGK
KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGEAAKLARYNKKPTITS
REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaaggcggagaagaagccggcggcgaagaagccagtggaggaggagcccgcg
gctgagaaggccgagaaggccccggctgggaagaagcccaaggcggagaagcggctgccg
gcgggcaagaccgcctccaaggagggcggcggcgagaagagggggaggaagaagggcaag
aagagtgtggagacctacaagatctacatcttcaaggtgctcaagcaggtgcaccctgac
atcggcatctcctccaaggccatgtcgatcatgaactccttcatcaacgacatctttgag
aagctggccggtgaggcagccaagctcgcccgctacaacaagaagcccaccatcacctcc
cgggagatccagacttctgtccgcctcgtcctcccaggagagctcgccaagcatgctgtc
tcggagggcaccaaggccgtcaccaagttcacctcctcttag

DBGET integrated database retrieval system