KEGG   Brachypodium distachyon: 100829343Help
Entry
100829343         CDS       T01717                                 

Definition
triosephosphate isomerase, chloroplastic
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100829343
   01230 Biosynthesis of amino acids
    100829343
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100829343
   00051 Fructose and mannose metabolism
    100829343
   00562 Inositol phosphate metabolism
    100829343
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100829343
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100829343
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100829343
  Exosomal proteins of bladder cancer cells
   100829343
  Exosomal proteins of melanoma cells
   100829343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 302 aa AA seqDB search
MAAPSSLASSHLSRLADLRRAAVNAAPQQHQLRLGCSRRRAQRLVAMAGSGKFFVGGNWK
CNGTKESISKLISDLNAATLENDVDVVVAPPFIYIDQVKNSLTDRIEVSAQNTWIGKGGA
FTGEISAEQLVDIGCQWVILGHSERRHVIGEDDQFIGKKAAYALSQNLKVMACIGELLEE
REAGKTFDVCFKQMKAFADNITNWTDVVIAYEPVWAIGTGKVASPEQAQEVHAAVRDWLK
TNVSADVASSVRIIYGGSVNAANCAELAKKEDIDGFLVGGASLKGPDFATICNSVTSKKV
AA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccgtcgtccctcgcctcctcccacctctcccgcctcgccgacctccgccgc
gccgccgtcaacgccgccccgcagcagcaccagctccgcctcggatgctcccgccgccga
gcgcagcgcctcgtcgccatggccggatccggcaagttcttcgtgggaggcaactggaag
tgcaacggaacaaaggaatccatcagcaagcttatctctgacttgaatgctgccactctc
gaaaacgacgtagatgttgtggtagcaccgccgttcatttatatcgaccaggtcaagaat
tcactcactgatcgcattgaggtgtctgctcagaatacgtggattggaaaaggaggagct
ttcaccggagagatcagtgcagagcaattggtggacattggctgtcaatgggttatcctt
ggtcactctgagcgtagacatgttattggtgaagatgatcagtttattgggaagaaggct
gcatatgccttgagtcaaaatcttaaggttatggcatgcataggagaactgttggaagag
agggaagctgggaaaacttttgatgtctgttttaagcagatgaaggctttcgcagataat
attacaaactggacagacgttgtaattgcatatgagcctgtctgggctattgggactgga
aaagttgcttctcctgagcaagctcaggaagttcatgctgctgttcgtgattggttaaaa
accaatgtatcagctgatgttgcttctagcgttcggattatctatggaggttctgtaaac
gcagcaaattgtgcagagctagcaaagaaggaagatatagatggcttccttgttggcggt
gcctctttgaagggtccggactttgccaccatttgcaattcggtgacttccaagaaagtt
gcggcctga

DBGET integrated database retrieval system