KEGG   Brachypodium distachyon: 100829639Help
Entry
100829639         CDS       T01717                                 

Definition
chalcone synthase 2-like
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
bdi  Brachypodium distachyon
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:bdi00941]
Organismal Systems; Environmental adaptation; Circadian rhythm - plant [PATH:bdi04712]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 400 aa AA seqDB search
MAAATMTVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFKMTKSDHLADLKEKF
KRMCDKSQIRKRYMHLTEEILEENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKE
WGQPRSRITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKD
LAENNRGARVLVVCSEITAVTFRGPHESHLDSLVGQALFGDGAAAVIVGADPEEHVERPL
FQLVSAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALEEAFKPLGIDDWN
SVFWVAHPGGPAILDMVEAKINLNKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAED
GHATTGEGMDWGVLFGFGPGLTVETVVLHSVPITAGAATA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgacgatgacggtggaggaggtgaggagggcgcagcgggcggagggaccg
gcgacggtgctggccattgggacggccacgccggccaactgcgtgtaccaggccgactat
ccggactactacttcaagatgaccaagagcgaccacctcgccgacctcaaggagaagttc
aagaggatgtgcgacaagtcgcagatccggaagcggtacatgcacctgacggaggagatc
ctggaggagaaccccaacatgtgcgcctacatggcgccctccctggacgcccgccaggac
atcgtggtggtggaggtccccaagctggggaaggcggcggcgcagaaggccatcaaggag
tggggccagccgcggtccaggatcacccacctcgtcttctgcaccacctcgggcgtcgac
atgccgggcgccgactaccagctcaccaagatgctgggcctccgcccctccgtcaagcgc
ctcatgatgtaccagcaaggttgcttcgcgggcggcacggtcctccggcttgccaaggac
ttggccgagaacaaccgtggagcgcgtgttctcgtggtgtgttccgagatcacagcagtg
actttccgtggccctcacgagtcgcacctcgactcgcttgtcgggcaggcgctctttggg
gacggcgctgcggccgtgatcgttggagcggacccggaagaacatgttgagaggccgttg
ttccagctcgtgtcggcagcccagacgatcctgccggactcggagggtgccattgacggg
cacctccgggaggtcgggctgacgttccatctcctcaaggacgttccggggctcatctcg
aagaacatcgagaaggcgctggaggaggcgttcaagccgctggggatcgacgactggaac
tcggtgttctgggtggcgcacccgggcggcccggccatcctggacatggtggaggccaag
attaacttgaacaaggagcggatgagggcaacgaggcacgtgctgtccgagtacggcaac
atgtccagcgcctgcgtgctcttcatcctcgacgagatgcgcaagcgctccgccgaggac
ggccacgccaccacgggcgaagggatggactggggcgtgctcttcggcttcggcccgggg
ctcaccgtcgagacggtcgtgctccacagcgtccccatcaccgccggcgctgccacagcg
taa

DBGET integrated database retrieval system