KEGG   Brachypodium distachyon: 100829721Help
Entry
100829721         CDS       T01717                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100829721
   00052 Galactose metabolism
    100829721
   00500 Starch and sucrose metabolism
    100829721
   00520 Amino sugar and nucleotide sugar metabolism
    100829721
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100829721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 467 aa AA seqDB search
MADEKLPKLREAVAGLGQISDKEKSGFISLVSRYLSGDEEHIEWAKIHTPTDEVVVPYDT
LESPPEDLEATKALLNKLAVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIESLN
KKYGSNVPLLLMNSFNTHDDTLKIVEKYSNSSIEIHTFNQSQYPRVVADEFLPWPSKGKT
DKDGWYPPGHGDIFPSLMNSGKLDLLLSQGKEYVFIANSDNLGAIVDMKILNHLIHKQNE
YCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDAHVDEFKSIEKFKIFNTNNLWVNLK
AIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDHAIGMNVPRSRFLPVKAT
SDLQLVQSDLYTLVDGFVTRNSARTNPSNPSIELGPEFKKVGSFLGRFKSIPSIVELDSL
KVSGDVWFGSGIVLKGKVTITAKPGVKLEIPDGAVLENKDINGVEDL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagaagctccccaagctgcgggaggccgtcgccggcctcggccagatcagt
gacaaggagaagtccgggttcatcagcctcgtctcccgctacctcagcggcgacgaggag
cacatcgagtgggccaagatccacacgccgaccgacgaggtggtggtgccctatgacacc
ctcgagtccccgcccgaagacttggaggccaccaaggcgctgctcaacaagctcgctgtg
ctgaagctcaacggtggcctggggaccaccatgggatgcacaggaccaaaatcagtcatc
gaagtgcgaaatgggttcacgttcctcgacctgattgtgatccagattgagtccctcaac
aagaagtacggaagcaatgtgcccctgcttttgatgaactccttcaacacccatgatgac
accttaaagattgtcgagaaatacagcaattcgagcatcgaaatccatacattcaaccag
agccagtatcctcgtgtggtagcggatgagttcttgccatggccttccaaggggaagact
gacaaggatggctggtatcctcctggccatggtgatatcttcccatccctcatgaacagt
ggcaagctcgatttattactctcacaggggaaagagtatgtgttcatcgcaaattcagat
aacttgggcgctatagtagacatgaagatattgaaccatttgatccacaagcagaatgaa
tattgcatggaggttaccccaaaaactttggccgatgtgaaaggtggcacgctcatatca
tatgaaggaagggttcagcttctggagattgcacaagttccagatgcacatgttgatgag
ttcaaatcaattgagaaattcaagatcttcaacaccaacaatctatgggtgaacttgaag
gctatcaaacgccttgttgaggctgatgcactcaagatggagatcattccaaaccctaag
gaagttgatggcgtgaaagttcttcagttggaaacagcagctggtgcggcaatcaggttc
tttgaccatgcaattggtatgaatgttccgaggtcacggttcctaccagtgaaggcaacc
tcagatttgcagctagtacagtctgatctgtataccttggttgatggctttgttacacgc
aattcagctagaacaaatccatcaaatccctcaattgagctgggccctgagttcaagaag
gttgggagtttccttggtcgcttcaagtcaattcctagcattgttgagctcgatagcttg
aaggtttctggtgatgtttggtttggttctggcattgtgctgaagggcaaggtgaccatc
acagcaaaacctggtgtcaagctggaaatcccagatggagcagtgctcgagaacaaagat
atcaatggcgttgaggacctttga

DBGET integrated database retrieval system