KEGG   Brachypodium distachyon: 100829805Help
Entry
100829805         CDS       T01717                                 

Definition
NADH-cytochrome b5 reductase-like protein-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bdi  Brachypodium distachyon
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bdi00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 311 aa AA seqDB search
MAALLLRRLAGTHRARTPLAAAAAAAGGAALFYASSPPTVAHLEEKGEEAAARVALNPEK
WLEFKLQEKATVSHDSQLFRFSFDPSTKLGLDVASCLVTRAPIGQEVEGRKKYVIRPYTP
ISDPDSKGHFDLLIKVYPDGQMSQYFANLKPGDVVEVKGPIEKLRYSPNMKRQIGMIAGG
TGITPMLQVVRAILKNPDDNTQVSLIYANVSPDDILLKRELDRLASSYPNFKVFYTVDKP
SSDWRGGAGYISKDMVLKGLPGPGEDSLILVCGPPGLMNHISGDKAKDRSQGEVSGLLKD
LGYTADMVYKF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctgctgctgcgtaggctcgcggggacccaccgcgcccgcacgccgcttgcc
gccgccgctgccgccgcgggcggggccgcgctcttctacgcctcgtcgccccccaccgtc
gcgcacctggaggagaagggggaagaagccgctgctagagttgcacttaaccctgagaag
tggttagagttcaaacttcaggagaaggcaacagttagtcatgattcacagctatttaga
ttttcatttgatccatccactaagctgggcctggatgttgcctcgtgtctcgtaacaagg
gctcccataggtcaggaagtggagggaaggaaaaaatacgttattcgcccgtacacacct
atctctgatccagattctaaaggacactttgacctgttaatcaaggtttatcctgatggg
caaatgagtcagtatttcgcaaatttgaagccaggggatgttgtcgaagtcaaagggccc
attgaaaagctaagatatagcccaaatatgaaaagacaaattggcatgattgctggtggt
actggtataacaccaatgctgcaggttgtcagggccatcctcaaaaaccctgatgacaac
actcaggtttctttaatttacgcgaacgtgtcaccagatgatatcttgctgaaaagggaa
ttagatagacttgccagcagctatcctaatttcaaggtattttatactgttgataaacca
tcaagtgactggaggggtggtgctggatatatatcaaaggacatggttttgaaaggtttg
ccgggcccaggggaggattctctcattcttgtgtgtggtcctccaggactgatgaatcac
atatctggagataaggcaaaggatagatcacagggagaggtcagtggcctcctgaaagat
ttaggatacacggcagacatggtatacaaattctga

DBGET integrated database retrieval system