KEGG   Brachypodium distachyon: 100830061Help
Entry
100830061         CDS       T01717                                 

Definition
cyclin-H1-1-like
Orthology
K06634  
cyclin H
Organism
bdi  Brachypodium distachyon
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:bdi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bdi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 328 aa AA seqDB search
MSDFQTSTHRERWIFQPHDLMDKWAAANQRSAETLAQYGTTRLKVDPVDGSISYPEPAPD
HVVGSSSVKPLSCEEEQLMRVFYEQKIQEVCAAFKFPHKIQATAIIYFKRFYLQWSVMEH
HPKHIMLTCVYSSCKVEENHVSAEELGKGIQQDHQIILNNEMIVLKSLDFDLIVYAPYRP
IEGFIDDMDGFCKAGNGAHQRLKELHQTANSHVDKMMLTDAPLLYSPGQLALAALSKSND
MHQVLNFERYLGSVFSRQKSNCPVEQFVQTINAINYLVDQLQIPTLKDMRHADRKLKHCL
DPSSHDEHKKKEKKSKHKSKRAASDAQL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatttccagacctccacgcaccgggagcggtggatcttccagccgcacgacttg
atggataagtgggcagcggccaaccagcgttctgccgagaccctcgcgcagtatggaacg
acacggttgaaggtggaccctgtcgatgggtcgatatcataccctgaacctgctcctgat
catgttgtcgggagctcgagtgtgaagcctctatcatgtgaagaggaacaattaatgcgg
gtattttacgagcaaaagattcaagaagtgtgtgcagcattcaagttccctcacaaaatt
caggctacagcaataatatatttcaagagattctatctacagtggtctgtaatggagcat
cacccaaagcatattatgttaacttgtgtgtattcttcttgcaaagtggaagaaaatcat
gtttctgctgaggaacttggtaaaggaattcagcaggatcaccagattattctaaataat
gagatgatcgttcttaaatctttggattttgatctgatcgtttatgctccttatcgtcct
atcgaaggatttattgacgacatggatggtttctgcaaggcaggcaatggtgcacaccaa
cgattaaaggagttgcaccaaactgcgaattctcatgttgacaaaatgatgttgactgat
gcaccccttctctattctcctggacagttggctttggctgctctgtccaagtccaatgat
atgcaccaggtcctcaattttgaaagatacttgggaagtgttttctcaaggcaaaaatct
aattgtccagtagaacaatttgttcagacaatcaatgcaattaattacttggttgaccag
cttcaaatacctactcttaaagacatgaggcatgctgatcgcaagctgaagcattgtctg
gatccaagctctcatgacgagcacaagaagaaagaaaagaagtcaaagcacaaatcgaaa
agggccgctagtgatgcccagctgtaa

DBGET integrated database retrieval system