KEGG   Brachypodium distachyon: 100830061Help
Entry
100830061         CDS       T01717                                 

Definition
cyclin-H1-1-like
Orthology
K06634  
cyclin H
Organism
bdi  Brachypodium distachyon
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100830061
  Replication and repair
   03420 Nucleotide excision repair
    100830061
Transcription machinery [BR:bdi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100830061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 328 aa AA seqDB search
MSDFQTSTHRERWIFQPHDLMDKWAAANQRSAETLAQYGTTRLKVDPVDGSISYPEPAPD
HVVGSSSVKPLSCEEEQLMRVFYEQKIQEVCAAFKFPHKIQATAIIYFKRFYLQWSVMEH
HPKHIMLTCVYSSCKVEENHVSAEELGKGIQQDHQIILNNEMIVLKSLDFDLIVYAPYRP
IEGFIDDMDGFCKAGNGAHQRLKELHQTANSHVDKMMLTDAPLLYSPGQLALAALSKSND
MHQVLNFERYLGSVFSRQKSNCPVEQFVQTINAINYLVDQLQIPTLKDMRHADRKLKHCL
DPSSHDEHKKKEKKSKHKSKRAASDAQL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatttccagacctccacgcaccgggagcggtggatcttccagccgcacgacttg
atggataagtgggcagcggccaaccagcgttctgccgagaccctcgcgcagtatggaacg
acacggttgaaggtggaccctgtcgatgggtcgatatcataccctgaacctgctcctgat
catgttgtcgggagctcgagtgtgaagcctctatcatgtgaagaggaacaattaatgcgg
gtattttacgagcaaaagattcaagaagtgtgtgcagcattcaagttccctcacaaaatt
caggctacagcaataatatatttcaagagattctatctacagtggtctgtaatggagcat
cacccaaagcatattatgttaacttgtgtgtattcttcttgcaaagtggaagaaaatcat
gtttctgctgaggaacttggtaaaggaattcagcaggatcaccagattattctaaataat
gagatgatcgttcttaaatctttggattttgatctgatcgtttatgctccttatcgtcct
atcgaaggatttattgacgacatggatggtttctgcaaggcaggcaatggtgcacaccaa
cgattaaaggagttgcaccaaactgcgaattctcatgttgacaaaatgatgttgactgat
gcaccccttctctattctcctggacagttggctttggctgctctgtccaagtccaatgat
atgcaccaggtcctcaattttgaaagatacttgggaagtgttttctcaaggcaaaaatct
aattgtccagtagaacaatttgttcagacaatcaatgcaattaattacttggttgaccag
cttcaaatacctactcttaaagacatgaggcatgctgatcgcaagctgaagcattgtctg
gatccaagctctcatgacgagcacaagaagaaagaaaagaagtcaaagcacaaatcgaaa
agggccgctagtgatgcccagctgtaa

DBGET integrated database retrieval system