KEGG   Brachypodium distachyon: 100830169Help
Entry
100830169         CDS       T01717                                 

Definition
malate synthase, glyoxysomal-like
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bdi  Brachypodium distachyon
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100830169
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100830169
   00630 Glyoxylate and dicarboxylate metabolism
    100830169
Enzymes [BR:bdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     100830169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 562 aa AA seqDB search
MSKTMPVPCYETPEGVDIRGRYDPEFASVLTRDALAFVAALHREFRGPVRHAMELRRDAQ
RCYDAGELPRFDPATRLVREGEWTCAPLPPAIADRTVEITGPADPRKMVINALNSGAKVF
MADFEDALSPTWENLMRGQVNLRDAVAGTISFRDDARGGRVYKLDDERGTAKLFVRPRGW
HLPESHVLVDNETAIGCLVDFGLYFFHNHAAFRAGQGAGYGPFFYLPKMEHSREARIWNA
VFSRAEKFAGIENGSVRATVLVETLPAAFQMDEILHELREHSAGLNCGRWDYIFSYVKTF
RGHPGRLLPDRALVGMAQHFMRSYSQLLIRTCHRRRVHAMGGMAAQIPIKDDAAANEAAL
ELVRGDKRREALAGHDGTWAAHPGLIPAIREVFEGHLGGRPNQIDAAIDSGADITEEDLL
QPPRGARTVEALRLNARVGVRYLAAWLAGSGSVPLYNLMEDAATAEISRVQNWQWVRHGA
ALDAGCGVEVRATPELLARVVEEEMERLRAEVGAQRFRAGRYAEAGRIFGRQCVAPELDD
FLTLDAYGLIVVHHPRASPSKL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagacgatgccggtgccatgctacgagacgccggagggcgtggacatccggggg
cgctacgacccggagttcgcgtccgtcctgacccgcgacgcgctggccttcgtggccgcc
ctgcaccgcgagttccggggccccgtcaggcacgccatggagctgcggcgggacgcccag
cggtgctacgacgccggcgagcttcccaggttcgaccctgcgacacggctcgtccgcgag
ggcgagtggacgtgcgcgccccttcccccggccatcgccgaccgcaccgtcgagatcacc
ggccccgccgaccccaggaagatggtcatcaacgccctcaactccggcgccaaggtcttc
atggcggacttcgaggacgcgctgtcgccgacgtgggagaacctgatgcgggggcaggtg
aacctgcgggacgccgtggccggcaccatcagcttccgcgacgacgcgcgcggcgggcgc
gtgtacaagctggacgacgagcgcggcacggcgaagctcttcgtccggccgcgcggctgg
cacctgccggagtcccacgtgctcgtagacaacgagacggccatcggctgcctcgtcgac
ttcgggctctacttcttccacaaccacgccgccttccgcgccggccagggcgccggctac
ggccctttcttctacctccccaagatggagcactcgagggaggcgaggatctggaacgcg
gtgttttcgagggcggagaagttcgcggggatcgagaacgggagcgtccgggcgacggtg
ctggtggagacgctgccggcggcgttccagatggacgagatcctccatgagctaagggag
cactcggcggggctcaactgcgggcggtgggactacatcttcagctacgtcaagacgttc
cgcggccacccgggccggctgctccctgaccgcgccctcgtcggcatggcccagcacttc
atgcgctcctactcacagctcctcatccgcacatgccaccgccgccgcgtccacgccatg
ggcggcatggcggcgcagataccgatcaaggacgacgcggcggcgaacgaggcggcgctg
gagctggtgaggggggacaagcggagggaggcgcttgcggggcacgacggcacgtgggcg
gcgcacccggggctcatcccggcgatccgggaggtcttcgagggacacctcggcgggagg
cccaaccagatcgacgccgccatcgactccggcgccgacatcacggaggaggacctgctg
cagccgccacgtggcgcgcgcacggtggaggcgctgcggctcaacgcccgcgtcggggtg
cggtacctggcggcgtggctggccgggtccgggtccgtgccgctgtacaacctgatggag
gacgcggccacggcggagatcagccgcgtgcagaactggcagtgggtgcggcacggcgcg
gcgctggacgccggctgcggcgtcgaggtccgcgccacgccggagctgctcgcgcgcgtc
gtggaggaggagatggagaggctccgggccgaggtcggggcccagaggttccgggccggg
cggtatgctgaggcgggaaggatctttggccggcagtgcgtggcgccggagctggacgac
ttcctcacgctcgacgcctatgggctcattgtcgtgcaccatcccagagcgtcgccgtcc
aagctctga

DBGET integrated database retrieval system