KEGG   Brachypodium distachyon: 100830773Help
Entry
100830773         CDS       T01717                                 

Definition
rae1-like protein At1g80670-like
Orthology
K14298  
mRNA export factor
Organism
bdi  Brachypodium distachyon
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100830773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 343 aa AA seqDB search
MANLTSLTSNPNPNKSFEVLPNPGDSLSSLSFSPKSNLLVATSWDNQVRCWEIVGSNSQP
KASISHDQPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQAQTVAMHDGPVKEIAWIPQ
MSLLVSGSWDKTLRYWDTRQQNPAHVQQLPERCYALSVNYPLMIVGTADRHIVIFDLRNP
QAEFKRIQSPLKYQTRCVAAFPDQQGFLVGSIEGRVGVHHIDDAQQSKNFTFKCHREGND
IFSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAFSRCPLPIPCSTFNMDGSIFAY
GVCYDWSRGAENHNPTNAKTSIYLHSPQEAEVKGKPRIATGRK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatctaaccagccttacctcaaacccgaacccgaacaagtcttttgaggtcctg
cctaatccaggcgactccctctcaagcctcagttttagcccaaagagtaacctgctagta
gcaacgtcctgggataaccaggtgaggtgttgggagatagttggtagtaacagtcagcca
aaggcatccatatcacatgatcagccggtgctctgctcggcttggaaggatgacgggact
actgtcttctctggaggctgcgataagcaggttaaaatgtggcctttgttgtctggtggg
caggctcagactgttgcaatgcatgatggacccgtcaaggagatagcatggattcctcaa
atgagtcttcttgtctctggaagctgggataagacattaaggtattgggacacaagacaa
caaaatcctgcccatgttcagcaacttccagagcgttgctatgctctttcagtgaattat
ccccttatgattgtgggaactgctgatcgtcatatcgtgatattcgacttacggaatcct
caggcggaatttaagcgtatccaatcaccactgaaataccagacacggtgcgtggctgca
ttccctgatcaacagggatttctggtgggttcaatagaaggaagagttggtgtgcatcat
attgatgacgcacagcaaagcaaaaacttcacttttaaatgtcacagggagggaaatgat
atattctctgtcaattcactcaactttcaccctgttcatcacacatttgccactgctgga
tccgatggtgctttcaatttctgggataaggatagcaaacagagattgaaggcttttagt
cggtgccctcttccgattccttgcagtaccttcaatatggatggctcaatatttgcttat
ggggtctgttatgactggagccgtggtgcagaaaaccataatcctacaaatgcaaagaca
tccatatatctccacagtccgcaggaagctgaggtgaaaggaaagccgcggatcgcaaca
ggacggaagtga

DBGET integrated database retrieval system