KEGG   Brachypodium distachyon: 100830829Help
Entry
100830829         CDS       T01717                                 

Definition
uncharacterized LOC100830829
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
bdi  Brachypodium distachyon
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100830829
Messenger RNA biogenesis [BR:bdi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100830829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1853 aa AA seqDB search
MPPPQPRELLAVIEAALLGPAPPSPGQRVELLHAVRDAAPAFRGLLSYPGPKASDRTQVE
AKEVRLPDMPPITLDDTDVQTALKLSDELNLNEIECVRLLVSANREWVLYGREPLEIYRL
AAGLWYMERRDLITSLYILLRSVVLDQGLDADLMYEIQNQMEALFSDGLQQRMITLVKEL
NREEPSGIGRPSSERYVLDFRGALVERRAIVSRERLSLSHCLALSALVKLMGPKEIKDAF
AILKDCAAEVNENTSVELQITYGVLFSLVITFVSDALSTSHEKASLPSSDSSFRHEFHEL
VTRTCNNTTVEGFVGVVRLAWTVLLMLTQDRSSARDSIINASSTLMTDIWSCMDIICRQN
AFEFLRERVIQTAAYQNDDDDIVYMYTGYAHKLMMCFLSHPTSKDKIKEIKEKAMNALSP
YVQARDHREDSSISGEQTGQPVNQPFVSLLELVGEIYQKEPELVHGNEELWTFVIYAGED
HTNTQTLVAFLGLLSTLASNEVGAAKVYELLQGKIYRSVGWNTLFDCLSIYEEKFKKSIQ
SSASMLPDFPEGDAQALVAYLAVLRKVVENGNPAERRKWFPDIEPLFKLLSYENVPPYLK
GALRNAITAFIKVSPLLKDAIWSYLEQYDLPVVTVPPGQHMATQVYDMRFELNEVEARRE
SYPSTISFLNLVNALIAEERNISDKGRRFMGIFKFVYEDVFGPFPQRAYADPREKWELAL
ACLEHFRMVLRMYDIKDDDIYAAFNTSGPSTSHASIERQLPVLELVKDFMCGKVAFRNIM
NIVLVGVDTLINERATQTYGILLEKTVHISLEIFILVMERDLVLADVYRPVYQPLDVVLS
QNHRQIVALLEFVRYDYLPQIQQCSIKIMGILSSRIVGLVQLLLKEDAAKSVIEDYAACL
EFRFDDFQVIENTKDDVGVLILQLLIDNISRPAPNMTHLLLKFDVNGPIERTVLKPKSHY
SCLKIILDNLEKVAKTDINALLHEFSFQLLYELCLDPLTCGPVMDLLSTTKYQFFSKHVG
TIAVSPLPKRNNNQALRISMLHERAWLLKMLALALHVSDISSSVYREACLAILSDTFGHC
AETMKSATIFQSPGTPVYTSNGPMHRNKVLDLLEVVQFRCPDTSMKYPQLLSNLNVESKI
EEILRNSATSEFGGVYYFSERGDRLIDLDAFHQKLLQMSQELNPQLSESEKGELKESFHH
ILKWAWKYNKNLEEQAAQLHMLTSWSQIVEVAVSRRMSLLDDRSQLLFELLDASLGATSS
PDCSVKMSYILTNVALTCMAKLRDERFICPTGADSDAVTCLDIISAKQLSNAACNSLLFK
LIMAILRSESSEHLRRRQYALLLSYFQYCGSVLDSDVPPSVIRFLLLEEQEGDDDELTLQ
KVLKEQSELARSNFAIIRKEAQAVIDLVTKDAIHGSEAGKAISFYVLDSLISIDHDKFFL
NQLQSRGILRSCLSDVSNYLSKDMSFSSEFSQRFCTVDSQFSLLLRISHHYGKHGSQILL
SMGALQNLSSCNLIGYQKKGNSKLSSNVVKERAGEVDKKRSLTAPVLRIVTSFTSLVDSD
DFLEVKNKVVREIVDFAKHHQFIFNSILRENISGANAFTLEQLNMAVSILSKVWAYEEDD
ECSYVQDLFSLMHSLFSLDFGSLNVIQSPNMIENQKSELVLFGLCFGLLSYLYFLATKKN
MRFEISYGDNSERGQQQPTLQMVSDLLNSVTLALERVGEEKYLLLNKVRDLNELSRKEVD
EIIKVCMKQDCISPNDNIRKRRYIAMIDLCCMAGNRDQLITLLLQVGECAITILLVHFHD
ESCAKDMSSFSDELLPILERLEHLKEDKVGRNLKLFHRSVTTLKELAVRSMSL
NT seq 5562 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgccacagccgcgcgagcttctagccgtaatcgaggcggcgcttctcggcccc
gcgccgccatccccggggcagcgcgtggagctcctccacgccgtccgcgatgccgccccc
gcattccgcgggcttctctcttacccggggccgaaggcgtccgatcgaactcaggtggag
gccaaggaggttcggctcccggacatgccaccaatcactcttgatgacaccgacgtgcag
actgcccttaagttgagtgacgaactcaaccttaatgagattgagtgtgttcgtttgctc
gtttctgccaacagagagtgggttctatatggtcgagagccactggaaatatataggctt
gcggctggtctttggtacatggagaggagagatcttataacttctctgtacattttgtta
cggtcggttgtactcgaccaagggcttgatgctgatctgatgtacgaaattcaaaatcaa
atggaggctctatttagtgatggtctccagcagcggatgattacccttgtaaaggagctt
aaccgagaagaaccatctggcattggccgaccaagctctgagcgttatgtgcttgatttc
agaggagctcttgttgaaaggcgtgccattgtctcgagagagagactaagcttgagccac
tgccttgctctttctgcactcgtcaaactaatgggtcccaaggagattaaggatgcattt
gcaatattgaaagactgtgcagctgaagtaaatgaaaatactagtgtggagcttcagatc
acatatggcgttctgttctctcttgtaataacttttgtttctgatgcgctaagtacttcc
catgagaaggcatctttgccatcgtctgattcctcattcagacatgaatttcatgagcta
gtgacgaggacatgtaacaataccaccgttgaaggatttgttggtgttgtgcggcttgca
tggactgttcttttgatgctaacacaagatcgaagtagcgcaagagactcaatcattaat
gcttcctccacattgatgacagatatttggtcatgtatggacattatctgtcgtcagaat
gcttttgagtttttacgggagcgagttatacaaacagctgcctaccagaatgacgatgat
gacattgtttacatgtatactggatatgcacacaagttgatgatgtgttttctctcccat
ccaacttctaaagacaagataaaggaaatcaaggaaaaagcaatgaatgctctcagtcca
tatgtgcaagcacgagatcatagagaagattctagcataagtggggaacagactggtcag
cctgttaaccagccttttgtatctttactggaactagttggagagatctatcagaaagag
cctgagctagtgcatggaaacgaggaactgtggacttttgtcatatatgcaggtgaagat
cacaccaatacgcaaactcttgtggccttccttggacttcttagtactctggcttccaat
gaagttggtgctgccaaagtctatgaattgctccagggaaaaatttaccgctcagttggg
tggaacactttgtttgattgcttatcaatttatgaagagaagttcaagaaatccattcaa
tcttccgcaagcatgttgcctgattttccagaaggggacgcacaggcgcttgttgcgtat
ttggctgtccttcggaaggtggttgaaaatggaaatccggctgaaagaaggaaatggttc
cctgacattgagcctttgtttaagcttctcagctatgaaaatgtgcccccatatttgaag
ggggctttgcgaaatgcaatcactgcattcatcaaagtttcacccctattgaaagatgca
atttggagttatcttgaacaatatgaccttccggtggttacagttccacctggccagcac
atggcaacacaggtctatgacatgaggtttgagttgaatgaagttgaagcaaggagggaa
agttatccgtcaaccatatcatttcttaacttggtcaatgctctcattgcagaagaacga
aacataagtgacaaagggcggaggttcatgggtatctttaagtttgtatatgaggatgtc
tttgggccttttccccagagagcctacgctgatccgcgggaaaagtgggaattggcactt
gcctgcctggagcacttccgcatggttttgcgcatgtacgacataaaggatgatgatatt
tatgctgcttttaacacatctggaccttcaacatcacatgcttcaatcgagagacagctc
ccggtgctagaactggtcaaagatttcatgtgtgggaaggttgctttccgtaatattatg
aacatcgtattagtgggtgttgacactcttattaatgagcgagcaacccaaacttatggg
attcttctggagaaaactgtccacatttctcttgaaatatttattcttgtaatggagaga
gacttggttcttgctgatgtctaccgtccagtctaccagcccttggacgttgtattatct
caaaatcatagacagattgttgctttgctggagtttgtacgatatgactaccttcctcaa
attcaacaatgttcaataaaaattatgggcatcctgagttctagaatagttgggcttgtc
cagttgctcttgaaggaagatgcagctaaatctgtaattgaggattacgctgcttgcttg
gagttccggtttgatgatttccaggtcatagagaacacgaaagatgacgttggtgttcta
atattgcagctacttattgacaacatttctcgcccagccccaaatatgactcatctactc
ttaaaatttgatgtcaatgggcccatagaacgaacagttctgaaaccaaaatcccactac
agttgtttaaagataatacttgacaaccttgaaaaggtggcgaagacagatataaacgcc
ttacttcatgagttcagttttcagcttctgtatgagttgtgtcttgatcctttaacttgc
ggacctgtaatggatctcctgagtacaacaaagtaccagttcttttctaagcatgttgga
actattgctgtttcaccactccccaaaaggaacaacaatcaagctcttcgcatcagcatg
ctacatgagagggcttggttgcttaagatgctagcattggcactacatgtatccgacata
tcatcatctgtgtatcgggaagcttgtctggctattcttagtgatacttttggtcactgt
gctgagaccatgaagagtgcaaccatatttcaatctcctggcactccggtttacactagc
aatggaccaatgcatagaaataaggttttggacttgcttgaagttgtacagttcagatgt
ccagacacttcgatgaaataccctcagttgctttcaaatctgaatgttgaatcgaagatt
gaggagatcctaaggaattccgcaacgtctgaatttggtggtgtatattatttttcggag
agaggtgatcgactgattgatctggatgccttccatcaaaaacttctccagatgtcacaa
gagttgaacccgcagttgagtgagtctgaaaaaggcgagttaaaagaatcattccatcat
attctgaaatgggcctggaaatataacaaaaatctcgaagaacaggcagcccagcttcac
atgttgactagctggtctcaaattgttgaagtagctgtttctaggaggatgtcattactt
gatgatcgttctcagttattgtttgagctgcttgatgcttcattgggtgccacgtcatct
ccagactgttcagtgaaaatgtcgtatattttgaccaatgtagcattgacctgtatggct
aaattgcgggatgaaagattcatatgcccaactggtgcagattctgatgcagttacttgc
cttgacattatttcggcaaaacagttatcaaatgcagcctgtaactcgttattgtttaag
ctcattatggcaatattgagaagtgaatcgtctgaacatttgagaagacgccaatatgca
ttactattgagttatttccagtattgtggtagtgttcttgactctgatgttcctccatca
gttattcgcttcttgctacttgaagaacaggagggagatgatgatgaactcactcttcaa
aaggttctgaaggaacagagtgaattagcgcgttccaactttgccatcataaggaaggaa
gctcaagcggtcatcgatttggttaccaaggatgctattcatgggagcgaagctgggaaa
gcaatttcattctatgttcttgattcattgataagtattgaccatgacaagtttttctta
aaccagcttcaaagtcgtggaattcttagatcatgtctaagtgatgttagcaactatttg
tcaaaggacatgtcattctcatcagagttttcacagcggttctgcactgttgattctcag
ttttcattacttctgagaatcagtcaccattatggtaaacacggctctcagattttgttg
tccatgggtgctttacaaaacctttcatcgtgcaacctcataggttatcagaaaaaggga
aattcaaaactaagctccaacgttgtgaaggaacgagctggggaagttgataagaagagg
tcacttactgcaccagtactgcggatagtcacatctttcacatcacttgtggactcggat
gattttttagaggtgaagaacaaagttgtacgtgagatagtggattttgcaaagcatcat
cagttcatttttaatagcattttgagagagaatatatctggagcaaatgccttcaccttg
gagcagcttaatatggcggtttctattctcagcaaggtatgggcatatgaggaagacgat
gaatgcagctatgtccaagatctattttccctgatgcattctctttttagtcttgatttt
gggtctctgaatgtcattcagtcaccaaacatgattgagaatcagaagtcagaactggta
ttgttcggtctctgctttggcctgctctcttacctatattttctggctacaaagaagaac
atgcgcttcgagatttcatatggtgataacagcgaacgcggtcaacagcaaccaacactg
caaatggtttcagatcttttgaactctgtaacacttgctctggagagagtaggcgaagaa
aaatacttgttgttaaataaggttcgtgacttgaatgagttatctaggaaggaggtcgac
gagataataaaagtatgcatgaagcaagattgcatctcgcccaacgataacatccgtaaa
aggaggtacattgcaatgatagatttgtgttgcatggctggcaaccgagaccagcttatt
acccttctactccaagtcggcgaatgtgccatcactattctcctcgttcattttcacgac
gagtcttgtgcaaaagacatgtcttcattttctgatgaactactccctatactggagagg
ctggagcatttaaaagaggacaaagttgggcgtaatctcaagttgttccacagatctgtg
accactctgaaagagttggcagtcagaagcatgtccttatga

DBGET integrated database retrieval system