KEGG   Brachypodium distachyon: 100831083Help
Entry
100831083         CDS       T01717                                 

Definition
uncharacterized LOC100831083
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100831083
Protein kinases [BR:bdi01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100831083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 721 aa AA seqDB search
MERRDNFLRPPAADNTPTAGKSITFPNAGDTATTNLTSSSGSSSSLTLSPPDFLRQVHAA
CKRQRPPSSQTMPPRAGRVLVARGEGPTKAGASPSVSQNPEGNAMQKQSGARGPSRLRNA
VPDQKNVKAAVVLLASNRNESLTTPSVLSTITYTHIQNASQNAQQKGEIGLLVDRKKSSL
DVSSSEMISQNALTAGDNFPMAEVAHDQGRKHQEPQIADAAVEMDVKYDAANLPQRGVEE
ACNQNHGEPMTRCSVIGSSVTAVSLHSGQNVRVLQSNQCPSPMQMPEYTVESSAVISGLA
PPKQQVPNLANDVSNKAVCGNQDSLPSQGQALSANDQSTSARDVGTSQASRGQKERRKNN
YDPEFFFKVNGKLYQKLGKIGSGGSSEVHKVISMERAIYALKKIKLKGRDYPTAYGFCQE
IEYLNKLKGKSNIIQLIDYEVTDKNLLKEGSVSPRDGRIKDDRYIYMVLEYGEIDLAHMV
AQKWKERNNSNMKIDENWLRFYWQQMLEAVNTIHEERIVHSDLKPANFMLVRGSLKLIDF
GIAKAIMNDTTNIQRDSQVGTLNYMSPEAFMCNEQDSGGNIVKCGRPSDIWSLGCILYQM
VYGKTPFADYKTFWAKFKAVTDRNHKINYEPVDNPWLIDLMQRCLAWDRDERWRIPQLLQ
HPFLVPLVAGELPRIDRDPCNMLMERVRVHWANPDVSRLCSELHDVIAKLEEDQCSPTTT
I
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggagaggagggataacttccttcgccccccagccgcggacaacacacccaccgccggc
aagagcatcacgttccccaacgccggagacacggccaccaccaacctgacctcgtcctcg
ggatcctcttcctccctaacgctatcccctccggacttcctgcgccaggtccatgcagcc
tgtaagcggcagaggcctcccagttcgcagaccatgcccccaagagcaggccgtgtcctg
gtggcccgaggtgaggggccaacaaaagcaggtgccagcccttctgtttcacagaatccg
gaaggaaatgctatgcagaagcagagtggcgcgcgggggccctccaggttgcgaaatgca
gtgcctgatcaaaagaatgttaaggccgctgttgtcctgctggcatcaaatcgaaatgag
tcgttgactacgccttcggtgttgagtactatcacatatacccatattcagaatgctagt
caaaatgcccagcagaagggtgaaatcggtctgttggtggatcgcaagaagtcatcgcta
gacgtttcttcatctgagatgatatctcaaaatgcattgacagcaggagataattttccc
atggctgaagtagcacatgaccaaggcaggaaacatcaggagcctcagatagctgatgca
gcagttgagatggatgtcaagtatgatgcagctaatttgccacagagaggggttgaagag
gcatgtaatcagaatcatggagagccaatgacccgttgctctgtcattggttcttctgtt
actgctgtgtcactacattcggggcaaaatgtacgagttcttcagagtaaccaatgccct
tcaccaatgcagatgcctgagtatacggtggaatcatctgcagttatatcaggtcttgct
cctccgaaacagcaggttcctaatcttgccaatgatgtctctaacaaagctgtctgtggc
aatcaagattccttgccatcccaaggccaagcattatctgcaaatgaccaatctacatct
gccagggatgttggtacttcacaagctagcaggggtcagaaggagcgtcgaaaaaacaat
tatgatcctgaatttttctttaaggtgaatgggaaactttatcaaaagcttggtaaaata
ggatccggggggagcagtgaagttcacaaagttatatcaatggagcgtgcgatatatgcc
ctgaaaaagatcaagctcaaaggtcgtgactatcctactgcttatggtttttgccaagaa
attgaatacctaaataagttgaaaggaaagagtaatatcatccagctaattgattacgag
gtcactgataaaaatttacttaaagaaggttctgtctcacctcgggatggaagaattaag
gatgaccgatatatttacatggtccttgagtacggggaaatcgacttagcacatatggtt
gcccagaagtggaaggagagaaacaactcaaatatgaagatagatgaaaattggctgcgc
ttttattggcagcaaatgcttgaagcagtcaatacaatacatgaggaacggatcgtgcac
tctgatctgaagcctgccaattttatgctcgtgaggggatcactgaaattaattgacttt
ggcattgccaaagctataatgaatgatacgacaaacattcaacgcgactctcaggtagga
acacttaactacatgtcacccgaagcattcatgtgcaatgagcaagattcaggtgggaac
attgtcaagtgtggacgtccatccgatatttggtctcttggttgtattctttatcagatg
gtgtatggtaagacaccatttgcggattacaagactttctgggccaaattcaaagctgtt
acagataggaaccacaagatcaattatgaacccgtagacaatccgtggcttattgatttg
atgcaaaggtgccttgcctgggaccgagatgaacggtggagaataccccaattgcttcaa
cacccatttcttgttcccctagtggctggtgagttgcctcgcattgaccgtgatccatgc
aatatgctgatggagagggtcagggttcactgggcaaatcccgatgtgtctagactttgt
tctgagcttcatgatgtgattgcaaagcttgaggaggatcaatgcagtcccaccactaca
atatag

DBGET integrated database retrieval system