KEGG   Brachypodium distachyon: 100831150Help
Entry
100831150         CDS       T01717                                 

Definition
(RefSeq) eukaryotic translation initiation factor
  KO
K03259  translation initiation factor 4E
Organism
bdi  Brachypodium distachyon
Pathway
bdi03013  RNA transport
Module
bdi_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100831150
Messenger RNA biogenesis [BR:bdi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100831150
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100831150
Translation factors [BR:bdi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100831150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100831150
NCBI-ProteinID: XP_003574030
UniProt: I1I4J9
Position
3
AA seq 207 aa AA seqDB search
MADVEPAVAAAVPETQEIAAEGDAASLKAPHKLQRQWTFWYDIQSKPKPGAAWGTSLKKG
YTFDTVEEFWSLYDQIFRPSKLQGNADFHLFKAGVEPKWEDPECANGGKWTVVSSRKTAL
DTMWLETCMALIGEQFDESQEICGVVASVRQRQDKLSLWTKTASNEAVQVDIGKKWKEVI
DYNDKMVYSFHDDSRSQKPSRGGRYNV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgttgagccggcggtggcggcggcggtgccggagactcaggagattgcggct
gagggtgacgcggcatcgttgaaggcgccgcacaagctgcagcggcagtggaccttctgg
tacgacatccagtccaagcccaagcccggcgccgcctggggcacctcgctcaagaaaggc
tacaccttcgacaccgtcgaagagttctggagcttgtatgatcaaatttttcgtccaagt
aaattgcaaggaaatgcggattttcatttattcaaggctggggtggaaccaaagtgggaa
gatccagagtgtgcaaatggtggcaaatggacagtggtatctagcagaaagactgccctt
gatactatgtggcttgaaacgtgtatggctctgattggagagcagttcgatgaaagccag
gaaatttgtggagttgttgctagtgtccgccagaggcaggataagctttcattatggact
aagactgccagtaatgaagctgttcaggtagacattggcaagaaatggaaggaagtcatt
gactacaatgataaaatggtctacagcttccatgatgactcaagaagtcagaaaccaagc
agaggcgggcgatacaacgtgtaa

DBGET integrated database retrieval system