KEGG   Brachypodium distachyon: 100831151Help
Entry
100831151         CDS       T01717                                 

Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00052  Galactose metabolism
bdi00561  Glycerolipid metabolism
bdi00600  Sphingolipid metabolism
bdi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100831151
  Lipid metabolism
   00561 Glycerolipid metabolism
    100831151
   00600 Sphingolipid metabolism
    100831151
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100831151
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100831151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 100831151
NCBI-ProteinID: XP_003574114
UniProt: A0A0Q3FC45
Position
3
AA seq 420 aa AA seqDB search
MEGNRGGSPWPRLPAPALMPMLLLVVLASVAAVGEAKVVHVGEAHRRSMLANGLGSTPPM
GWNSWNHFGCDGNGEVVIRETADALISTGLAAAGYRYVNLDDCWAESERDAKGNLVAKKS
TFPNGIKALADYVHSKGLKLGIYSDAGYKTCAKAQPGSLGYEEQDAKTFASWGVDYLKYD
NCNNGDLKPLERYPEMSKALMKAGHPIYFSICEWGDMHPARWAAAYGNSWRTTNDIEDTW
DSMTSRADQNEVWAEYARPGGWNDPDMLEVGNGGMTNDEYIVHFSIWAISKAPLIIGCDV
RHMSQDTYDILANTEVIAVNQDPLGVQGKKVRMEGSNEIWAAPLSGYRTAVVLLNRHAKD
EAEITARWDDIGLPAGMAVEARDLWQHKTLDAKFTDKMPFNVTPHAARMFLLTPLTSQIN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggagggcaaccgtggaggctcgccgtggcctaggctgccggcgccggcgctgatgccg
atgctgctgctggtggtgctggcgagcgtcgccgccgtgggcgaggccaaggtggtgcac
gtgggagaagcccaccggaggagcatgctggccaatggcctcggctccactccacccatg
gggtggaacagctggaatcacttcgggtgcgacggcaacggcgaggtcgtcatcagggag
acagccgacgcgctcatctccaccgggctcgcagccgccggctaccgatacgtcaacctt
gatgattgctgggcagaatccgaacgtgatgccaaggggaaccttgtggcgaaaaagagt
acgttcccgaacgggataaaagcgctcgctgactacgtccacagcaaggggctcaaatta
gggatctactccgacgcaggatacaagacctgcgccaaggctcagcctggatccctcggg
tacgaggagcaggacgcaaaaactttcgcgtcatggggagtggattacctcaagtacgac
aactgcaacaacggcgacctgaagccgctggagaggtaccctgagatgagcaaggcgctg
atgaaggccggccacccgatctacttctcgatctgcgaatggggcgacatgcacccggcg
cgatgggccgcggcttacggcaacagctggagaaccaccaacgacatcgaggacacctgg
gacagcatgacgtcgagggcggaccagaacgaggtgtgggccgagtacgcacgccccggc
ggctggaacgatcctgacatgctggaagtgggcaatggagggatgaccaacgacgagtac
atcgtgcacttcagcatctgggcaatctccaaggcgcctctgatcatcggctgcgacgtg
aggcacatgtcgcaggacacctacgacatcctggccaacacggaagtgatcgccgtcaac
caagatcctctcggcgtacaggggaagaaagtgaggatggaggggagcaacgagatctgg
gctgcgccgctgtcggggtacaggacggcggtggtgctgctgaacaggcacgccaaggac
gaggccgagatcacggcgcgctgggacgacatcggcctcccggccggcatggccgtcgag
gccagggacctctggcaacacaagacgctggacgccaagttcacggacaagatgcccttc
aacgtgacgccgcacgccgcccggatgttcctgctgacgcctctcacgtcgcagatcaac
tga

DBGET integrated database retrieval system