KEGG   Brachypodium distachyon: 100831151Help
Entry
100831151         CDS       T01717                                 

Definition
alpha-galactosidase-like
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bdi  Brachypodium distachyon
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bdi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bdi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bdi00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:bdi00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 400 aa AA seqDB search
MLLLVVLASVAAVGEAKVVHVGEAHRRSMLANGLGSTPPMGWNSWNHFGCDGNGEVVIRE
TADALISTGLAAAGYRYVNLDDCWAESERDAKGNLVAKKSTFPNGIKALADYVHSKGLKL
GIYSDAGYKTCAKAQPGSLGYEEQDAKTFASWGVDYLKYDNCNNGDLKPLERYPEMSKAL
MKAGHPIYFSICEWGDMHPARWAAAYGNSWRTTNDIEDTWDSMTSRADQNEVWAEYARPG
GWNDPDMLEVGNGGMTNDEYIVHFSIWAISKAPLIIGCDVRHMSQDTYDILANTEVIAVN
QDPLGVQGKKVRMEGSNEIWAAPLSGYRTAVVLLNRHAKDEAEITARWDDIGLPAGMAVE
ARDLWQHKTLDAKFTDKMPFNVTPHAARMFLLTPLTSQIN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctggtggtgctggcgagcgtcgccgccgtgggcgaggccaaggtggtgcac
gtgggagaagcccaccggaggagcatgctggccaatggcctcggctccactccacccatg
gggtggaacagctggaatcacttcgggtgcgacggcaacggcgaggtcgtcatcagggag
acagccgacgcgctcatctccaccgggctcgcagccgccggctaccgatacgtcaacctt
gatgattgctgggcagaatccgaacgtgatgccaaggggaaccttgtggcgaaaaagagt
acgttcccgaacgggataaaagcgctcgctgactacgtccacagcaaggggctcaaatta
gggatctactccgacgcaggatacaagacctgcgccaaggctcagcctggatccctcggg
tacgaggagcaggacgcaaaaactttcgcgtcatggggagtggattacctcaagtacgac
aactgcaacaacggcgacctgaagccgctggagaggtaccctgagatgagcaaggcgctg
atgaaggccggccacccgatctacttctcgatctgcgaatggggcgacatgcacccggcg
cgatgggccgcggcttacggcaacagctggagaaccaccaacgacatcgaggacacctgg
gacagcatgacgtcgagggcggaccagaacgaggtgtgggccgagtacgcacgccccggc
ggctggaacgatcctgacatgctggaagtgggcaatggagggatgaccaacgacgagtac
atcgtgcacttcagcatctgggcaatctccaaggcgcctctgatcatcggctgcgacgtg
aggcacatgtcgcaggacacctacgacatcctggccaacacggaagtgatcgccgtcaac
caagatcctctcggcgtacaggggaagaaagtgaggatggaggggagcaacgagatctgg
gctgcgccgctgtcggggtacaggacggcggtggtgctgctgaacaggcacgccaaggac
gaggccgagatcacggcgcgctgggacgacatcggcctcccggccggcatggccgtcgag
gccagggacctctggcaacacaagacgctggacgccaagttcacggacaagatgcccttc
aacgtgacgccgcacgccgcccggatgttcctgctgacgcctctcacgtcgcagatcaac
tga

DBGET integrated database retrieval system