KEGG   Brachypodium distachyon: 100831151Help
Entry
100831151         CDS       T01717                                 

Definition
alpha-galactosidase-like
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bdi  Brachypodium distachyon
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100831151
  Lipid metabolism
   00561 Glycerolipid metabolism
    100831151
   00600 Sphingolipid metabolism
    100831151
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100831151
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100831151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 400 aa AA seqDB search
MLLLVVLASVAAVGEAKVVHVGEAHRRSMLANGLGSTPPMGWNSWNHFGCDGNGEVVIRE
TADALISTGLAAAGYRYVNLDDCWAESERDAKGNLVAKKSTFPNGIKALADYVHSKGLKL
GIYSDAGYKTCAKAQPGSLGYEEQDAKTFASWGVDYLKYDNCNNGDLKPLERYPEMSKAL
MKAGHPIYFSICEWGDMHPARWAAAYGNSWRTTNDIEDTWDSMTSRADQNEVWAEYARPG
GWNDPDMLEVGNGGMTNDEYIVHFSIWAISKAPLIIGCDVRHMSQDTYDILANTEVIAVN
QDPLGVQGKKVRMEGSNEIWAAPLSGYRTAVVLLNRHAKDEAEITARWDDIGLPAGMAVE
ARDLWQHKTLDAKFTDKMPFNVTPHAARMFLLTPLTSQIN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctggtggtgctggcgagcgtcgccgccgtgggcgaggccaaggtggtgcac
gtgggagaagcccaccggaggagcatgctggccaatggcctcggctccactccacccatg
gggtggaacagctggaatcacttcgggtgcgacggcaacggcgaggtcgtcatcagggag
acagccgacgcgctcatctccaccgggctcgcagccgccggctaccgatacgtcaacctt
gatgattgctgggcagaatccgaacgtgatgccaaggggaaccttgtggcgaaaaagagt
acgttcccgaacgggataaaagcgctcgctgactacgtccacagcaaggggctcaaatta
gggatctactccgacgcaggatacaagacctgcgccaaggctcagcctggatccctcggg
tacgaggagcaggacgcaaaaactttcgcgtcatggggagtggattacctcaagtacgac
aactgcaacaacggcgacctgaagccgctggagaggtaccctgagatgagcaaggcgctg
atgaaggccggccacccgatctacttctcgatctgcgaatggggcgacatgcacccggcg
cgatgggccgcggcttacggcaacagctggagaaccaccaacgacatcgaggacacctgg
gacagcatgacgtcgagggcggaccagaacgaggtgtgggccgagtacgcacgccccggc
ggctggaacgatcctgacatgctggaagtgggcaatggagggatgaccaacgacgagtac
atcgtgcacttcagcatctgggcaatctccaaggcgcctctgatcatcggctgcgacgtg
aggcacatgtcgcaggacacctacgacatcctggccaacacggaagtgatcgccgtcaac
caagatcctctcggcgtacaggggaagaaagtgaggatggaggggagcaacgagatctgg
gctgcgccgctgtcggggtacaggacggcggtggtgctgctgaacaggcacgccaaggac
gaggccgagatcacggcgcgctgggacgacatcggcctcccggccggcatggccgtcgag
gccagggacctctggcaacacaagacgctggacgccaagttcacggacaagatgcccttc
aacgtgacgccgcacgccgcccggatgttcctgctgacgcctctcacgtcgcagatcaac
tga

DBGET integrated database retrieval system