KEGG   Brachypodium distachyon: 100831505Help
Entry
100831505         CDS       T01717                                 

Definition
probable glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bdi  Brachypodium distachyon
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100831505
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100831505
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100831505
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100831505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 531 aa AA seqDB search
MAGKEGEEEVYVASIDQGTTSTRFIVYDRHARPVASHQLEFKQHYPEAGWVEHDPMEIME
SVRACMANALEKAAADGLNVSAGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDVRTSS
ICRRLEGELAGGRTHFVETCGLPISTYFSALKLLWLMENVDAVKDAVRAGDALFGTIDTW
LIWNLTGGIGGKDGKQIGQHVTDCSNASRTMLMNLKALDWDKPTLKALGIPADILPKIIS
NSEKIGLVADGFPLAGVPISGCLGDQHAAMLGQLCQKGEAKSTYGTGAFILLNTGEEVTQ
SSHGLLSTIAYKLGPSAPTNYALEGSIAIAGAAVQWLRDSLGIIRSAAEIEELAESVQDS
GGIYFVPAFNGLFAPWWRDDARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDA
GEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTAIGAAYAAGLAA
GVWTKEQIFAGLHKENTTVFRPKLDEAHRKKRGDSWYKAVSRSFDLADLSL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaaggagggggaggaggaggtgtacgtggcgtcgatcgaccagggcaccacc
agcaccaggttcatcgtctacgaccgccacgccaggcccgtcgcctcgcaccagctcgag
ttcaagcagcactacccggaggcaggatgggtcgagcatgatcctatggagatcatggag
agcgtgagggcgtgcatggcaaatgcacttgagaaagctgctgctgatggattaaatgtg
tctgctggcttgaaggctatagggatcacaaatcagagggagaccactgttatgtggagc
aaatccacaggccttccgctctataatgccattgtgtggatggacgttcgcacaagctcc
atttgcaggagattggaaggtgagctggcgggtggtagaacacactttgtggagacatgt
ggattaccaatcagtacctattttagtgctctgaagctactttggttgatggaaaatgtt
gatgctgtcaaggatgcagtccgggccggggatgcattatttggcacaatcgacacctgg
ctgatctggaacctgacaggaggcattggcggtaaagatggaaaacagatcggacagcat
gtcacagattgctcaaatgcatctcgcacgatgcttatgaatctaaaggcacttgattgg
gacaagcctacactcaaggcattaggaattcctgctgacatcttaccaaagattatcagt
aactcagagaaaattggtttggttgccgatgggtttcctttggctggtgtccccatctca
gggtgtctaggagatcagcatgcagcaatgctcgggcaattatgccaaaaaggtgaagca
aaaagcacctatggaactggtgccttcatccttctcaacacaggggaggaggttacccaa
tcttcccatgggcttcttagcacaattgcttataagcttggcccaagcgcacccactaat
tatgctctagaaggctcgattgcaattgctggtgcagcagttcagtggttgagggacagc
ctcggaatcattcgctcagcagcagaaattgaagagttggctgaaagcgtgcaggattca
ggtgggatatactttgtgccagcattcaatggattgttcgcaccatggtggagggatgat
gccagggggatctgcataggaatcacaaggttcaccaataaggggcacattgctcgagca
gtgcttgagagtatgtgctttcaggtgaatgatgtcctcagctccatgcacaaggatgct
ggggaggcaggagaagtcaagagtgctgaaggagagttcttgttgcgtgttgatggtggt
gctactgtcaataaccttctcatgcagattcaggctgatttgctgggtagtcctgttgtc
agaccagctgacatcgagacaacagccattggagccgcatatgcagcagggttagctgct
ggtgtctggacaaaggagcaaatatttgcaggtttgcacaaggagaacacgacagtcttc
cgcccgaaattggatgaggcacacaggaagaagagaggggactcctggtacaaggcggtc
tcaagatcatttgatctggctgatctttctctctag

DBGET integrated database retrieval system