KEGG   Brachypodium distachyon: 100831513Help
Entry
100831513         CDS       T01717                                 

Definition
magnesium-chelatase subunit H-like
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100831513
Enzymes [BR:bdi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     100831513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1403 aa AA seqDB search
MSSSLVSAPFAPAATSRAQRKRLSAPLHSFLLSRRSHNQQQHASGTRPGTIRCAVAGNGL
FTQTNPDVRRVVPPRGLLPRVKIVYVVLEAQYQSSVTAAVQSLNADPRRAAEFEVSGYLV
EELRDASTYESFKEDLSDANVFIGSLIFVEELAVKVRDAVERERDRMDAVLVFPSMPEVM
RLNKLGSFSMSQLGQSKSPFFQLFKRNKKNSAGFADSMLKLVRTLPKVLKYLPSDKAQDA
RLYILSLQFWLGGSPDNLQNFLKMIAVSYVPALKGNPGITYDDPVLFLDAGIWHPLAPTM
YDDVKEYLNWYGTRRDADERLKDPDAPIIGLVLQRSHIVTGDDGHYVAVIMELEARGAKV
IPIFAGGLDFSGPTEKYLVDSVTKKPFVDAVVSLTGFALVGGPARQDHPKAIAALQKLDV
PYIVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRSGKFLSVG
SGHSFSYPFLRKSHALHKRVEQLCTRAVRWAQLKRKTKEDKRLAITVFSFPPDKGNVGTA
AYLNVFSSIYSVLRDLKKDGYNVDGLPETPEELIEEVIHDKEAQFNSPNLNVVYRMNVRE
YQALTPYASMLEENWGKAPGHLNSDGENLLVYGKQYGNIFIGVQPTFGYEGDPMRLLFSK
SASPHHGFAAYYTYVEKIFKADAVLHFGTHGSLEFMPGKQVGMSDACYPDSLIGNIPNIY
YYAANNPSEATVAKRRSYANTISYLTPPAENAGLYKGLKQLSELIASYQSLKDTGRGNQI
VSSIISTARQCNLDKDVDLPEEGEELPANERDLVVGKVYAKIMEIESRLLPCGLHVIGEP
PTAVEAVATLVNIAALDRPEENIYALPGILAATVGRTIEDVYRGSDKGVLDDVELLKQIT
EASRGAVGAFVEKSTNSKGQVVDVSNKLSSILGFSLSEPWVEYLSQTKFIRADREKLRNL
FGFLGECLKLIVADNELGALKLALDGSYVEPGPGGDPIRNPKVLPTGKNIHALDPQSIPT
AAAMKSAKIVVDRLLERQKADNGGKYPETIALVLWGTDNIKTYGESLAQVMWMVGVLPVS
DAFGRVNRVEPVSLEELGRPRIDVVVNCSGVFRDLFINQMNLLDRAVKLVAELDEPAEMN
FVRKHALEQAAELGVSVREAATRVFSNASGSYSSNVNLAVENATWTDEKQLQDMYLSRKS
FAFDSDAPGVGMLEKRKTFELALATADATFQNLDSSEISLTDVSHYFDSDPTKLVQGLRK
DGRAPASYIADTTTANAQVRTLSETMRLDARTKLLNPRWYEGMMKSGYEGVREIEKRLTN
TVGWSATSGQVDNWVYEEANTTFIEDEEMRKRLMDTNPNSFRKLLQTFLEANGRGYWDTS
EDNLERLRELYSEVEDKIEGIDR
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtccctggtgtcggcgccgttcgcgccggccgccacgagccgggcgcagagg
aagcgcctgtccgcgccgctgcattcgttcctcctcagccgccgcagccacaaccagcag
cagcacgcgtccggaacgcgcccggggacgatccggtgcgcggtggccgggaacgggctc
ttcacccagaccaacccggacgtgcgccgcgtggttcccccacggggcctgctgccgcgc
gtcaagatcgtctacgtcgtcctggaagctcagtaccagtcctcggtcaccgccgccgtg
cagagcctcaacgccgacccgcgccgcgccgccgagttcgaggtctccggctacctcgtg
gaagagctccgcgacgcgtccacctacgaatccttcaaggaagacctctccgacgccaac
gtcttcatcggctcgctcatcttcgtggaagagctggccgtcaaggtccgggacgccgtg
gagcgagagcgtgaccggatggacgccgtgctcgtgttcccgtccatgccggaagtcatg
cggctcaacaagctgggctccttcagcatgtcccagctgggccagtccaagagccccttc
ttccagctcttcaagcgcaacaagaagaactccgccggcttcgccgacagcatgctgaaa
cttgtccggacgctccccaaggtgctcaagtacttgccctccgacaaggcacaggacgcc
aggctttacatcctcagcctccagttctggctcggcgggtccccggataacctgcagaac
ttcctcaagatgatcgccgtgtcctacgtgccggcgctcaaggggaaccctgggatcact
tacgacgaccctgttcttttcctcgacgccggcatctggcacccgctggcgcccaccatg
tacgacgacgtcaaggagtacctcaactggtacggcacccgccgcgacgccgacgagcgg
ctcaaggaccccgacgcgccgatcatcggcctcgtgctgcagaggagccacattgtgaca
ggagatgatgggcattatgtggccgtgatcatggagcttgaggcgagaggtgccaaggtg
atcccgatcttcgccggggggctcgacttctcgggcccgacggagaagtaccttgtggac
tcggtgacgaagaagccgttcgtcgacgccgtggtttcgctcaccgggtttgcgcttgtc
ggcgggccggctaggcaggaccaccccaaggccatcgccgccctgcagaagctcgacgtg
ccgtacattgtggccttgccgctcgtgttccagaccacggaggagtggctcaacagcacg
ctcgggctgcatccgatccaggtggctctgcaggtggcgctcccggagcttgacggcggc
atggagcccatcgtcttcgccggccgcgaccccagatcaggcaagttcctctccgttggt
tctggccattcattcagttatccctttctccggaaatcgcatgcgttgcacaagagggtg
gagcagctctgcactagagcagtcagatgggcgcaactcaagaggaaaaccaaggaggac
aagaggctagccatcaccgtgttcagcttcccgccggacaagggcaacgtgggcacggcg
gcatacctgaacgtgttcagctccatctactccgtgctccgggacctcaagaaggacggc
tataacgtcgacggcctccctgagacgccggaggagctcatcgaggaggtgatccacgac
aaggaggcccagttcaacagcccgaacctcaacgtggtgtaccggatgaacgtccgtgag
taccaggccctgaccccttacgcctccatgcttgaggagaactggggcaaggcccccggc
cacctcaactccgacggcgagaacctcctcgtctacggcaagcagtacggcaacatcttc
atcggcgtgcagcccacctttgggtacgaaggcgacccgatgcggctcctcttctccaag
tctgccagcccgcaccacggcttcgcggcgtactacacctatgtcgagaagatcttcaaa
gccgacgccgtcctccatttcggcacccacgggtcgctggaattcatgccggggaagcag
gtgggcatgagcgatgcgtgctacccggacagcttgatcggcaacatccccaacatctac
tactacgcggcgaacaacccgtcggaggcgactgttgccaagcgccggagctacgccaac
accatcagctacctgacgccgccggccgagaacgccgggctctacaaggggctcaagcag
ctgtcggagctcatcgcctcctaccagtccctcaaggacaccgggcgcggcaaccagatt
gtcagctccatcatcagcacggcaaggcagtgcaacctcgacaaggacgtcgacttgccg
gaggaaggcgaggagctgccggcaaacgagcgtgacctcgtcgtcggcaaggtgtatgcc
aagatcatggagatcgagtcgcggctgctgccgtgtgggctgcacgtgatcggcgagccg
ccaactgccgtcgaggccgtggccacgctggtcaacatcgctgcccttgaccggccggag
gagaacatctacgcccttcccggcatcctcgccgccacggtggggaggaccatcgaggac
gtgtacaggggaagcgacaagggggtgctggatgacgtggagcttctgaagcagatcacc
gaggcctcacggggcgccgtcggggccttcgtcgagaagagcacgaacagcaaggggcag
gttgtcgatgtcagcaacaagctcagctccatcctcgggttcagcctctcggagccatgg
gtggagtacctgtcacagaccaagttcatcagggcagacagggagaagctgaggaacctg
tttgggttcctgggcgagtgcctgaagctgatcgtggcagacaacgagctgggagccttg
aagcttgccctggatgggagctacgtggagcctggccccggcggcgacccgatccggaac
cccaaggtcctccccacggggaagaacatccatgccctcgacccgcagtcgatccccacc
gccgccgccatgaagagcgccaagatcgtggtcgaccggctactggagcgccagaaggcc
gacaatggcggcaagtacccggagaccatcgcgctcgtgttgtggggcactgacaacatc
aagacctatggggagtccctggcccaggtgatgtggatggtgggcgtcctcccggtctcc
gacgcctttggccgcgtcaaccgcgtggagcccgtcagcctcgaggagctcggccggccc
cgcatcgacgtcgtcgtcaactgctccggcgtcttcagagacctcttcatcaaccagatg
aatctgctggaccgggcggtgaagctggtggcggagctggacgagccggcggagatgaac
ttcgtgcggaagcacgcgctggagcaggcggcggagctgggcgtgtcggtgcgggaggcg
gcgacgcgggtcttctccaacgcctccggctcctactcctccaacgtgaacctggcggtg
gagaacgcgacgtggacggacgagaagcagctccaggacatgtacctgagccgcaagtcc
ttcgccttcgactccgacgcgcccggcgtcggcatgctcgagaagcgcaagaccttcgag
ctcgccctcgccaccgccgacgccaccttccagaacctcgactcctccgagatctcgctc
acggacgtcagccactacttcgattcggaccccacaaagctcgtccagggcctccgcaag
gatggccgcgcaccggcgtcctacatcgccgacacgacgacggcgaacgcgcaggtgcgg
acgctgtcggagacgatgcggctggacgcgaggaccaagctgctgaaccctagatggtac
gaagggatgatgaagagcgggtacgagggggtgagggagatcgagaagcggctgaccaac
accgtcggctggagcgccacctccggtcaggtggacaactgggtctacgaggaggccaac
acgaccttcatcgaggacgaggagatgcggaagcggctcatggacaccaacccaaactcc
ttcaggaagctgctgcagaccttcctcgaggccaatggcagggggtactgggacacctcc
gaggataacctggagaggctcagggagctctactccgaggttgaagacaagatcgaaggg
attgaccgctga

DBGET integrated database retrieval system