KEGG   Brachypodium distachyon: 100831571Help
Entry
100831571         CDS       T01717                                 

Definition
(RefSeq) calcineurin subunit B
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bdi  Brachypodium distachyon
Brite
Protein phosphatases and associated proteins [BR:bdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100831571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_9 EF-hand_5 DUF3427
Motif
Other DBs
NCBI-GeneID: 100831571
NCBI-ProteinID: XP_003574532
UniProt: I1I7D6
Position
3
AA seq 175 aa AA seqDB search
MGSTSSMLTQYDIEEVQDHCSHAFSQQEIVSLYHRFCQLDRNGGGFVSADEFMTVPEFAV
NPLSQRLLRMLDGLNFKEFVAFLSAFSPHTSLQNKIEFIFRVYDTDCNGKVAFDDILSIL
RDLTGSFMTEQQRQKVLTHVLEEAGYTKDSHFTLTDFMKILGNSDLKMEVEVPID
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggagcacctcctccatgctcacccagtacgacatcgaggaggtccaggaccactgc
agccacgccttctcgcagcaggagatcgtgtcgttgtaccaccggttctgccagctcgac
cgcaacggcggcggcttcgtctctgccgacgagttcatgacggtccccgagttcgccgtc
aaccctctctcccagaggctcctgaggatgctggatgggctgaacttcaaggaatttgtg
gcattcttgtcggcgttcagtccccacacaagcctgcagaacaagattgaatttattttc
agggtctatgacactgactgcaatgggaaggttgcatttgatgatatcttgagcatattg
cgagatctgacgggttcttttatgactgagcaacaacggcagaaagttctgactcatgtg
ttagaagaagctggctatacaaaagattcacatttcactctaacagatttcatgaagatt
cttggcaattctgatctcaagatggaggttgaagtacctattgactaa

DBGET integrated database retrieval system