KEGG   Brachypodium distachyon: 100831660Help
Entry
100831660         CDS       T01717                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
bdi  Brachypodium distachyon
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100831660
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100831660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 453 aa AA seqDB search
MGKPKPSSAAPPPTRPSAASAPKTVHSALLTYTSMLSLLSLCPPFVILLWYTMVHADGSV
VRTYEHLRDHGLLEGLKAIWPMPTMAAWKIIFGFALFEAVLQLLLPGKRFEGPISPSGNV
PVYKANGLQAYAVTLVTYLSMWWFGLFNPAIVYDHLGEIYSALVFGSFVFCIFLYIKGHV
APSSSDSGSSGNAIIDFYWGMELYPRIGKHFDIKVFTNCRFGMMSWAVLAVTYCIKQYEM
NGRVADSMLVNTALMLIYVTKFFWWESGYWCTMDIAHDRAGFYICWGCLVWVPSIYTSPG
MYLVNHPVNLGPQLAVSILLAGILCIYINYDCDRQRQEFRRTNGKCSIWGKAPSKIVASY
QTTAGETKTSLLLTSGWWGLSRHFHYVPEILSAFFWTVPALFDHFLPYFYVIFLTILLLD
RAKRDDDRCSSKYGKYWKMYCNKVPYRVVPGIY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcccaagccctcctccgccgcgccgccgccgacgcgtccgtcggcggcctcc
gcgccgaagacggtgcactcagcgctgctcacatacacctccatgctctcactcctctcc
ctctgcccacccttcgtcatcctcctgtggtacaccatggtgcacgcggatgggtcggtg
gtgcggacctacgagcacctccgcgaccacgggcttctggaagggctcaaggccatctgg
cccatgcccaccatggccgcctggaagatcatcttcggctttgccctgtttgaggccgtc
ctgcagctactcctccccgggaagcgcttcgagggtcccatctcaccctccgggaacgtg
cccgtctacaaggcaaatggcttgcaagcatatgcagtgaccttggtcacttacctaagc
atgtggtggtttggactttttaaccctgcaatagtatatgatcacttgggggagatatat
tctgctcttgtcttcgggagctttgtgttttgtattttcctgtacataaagggtcatgta
gcaccatcttcatctgattctggatcctcaggaaatgcaataatagatttctactgggga
atggagttgtatcctcggattggtaaacattttgacatcaaagtcttcacaaactgccgt
tttgggatgatgtcctgggctgttcttgctgtaacctactgcataaagcagtatgaaatg
aatggcagagttgcggattctatgcttgtgaatactgcactgatgctgatctatgtcact
aagtttttctggtgggagtctggatattggtgtaccatggacattgctcatgacagagct
ggtttctatatttgctggggatgcttggtgtgggttccatcaatatatacttctcctggg
atgtaccttgtgaatcatcctgtgaatttgggtccccagctagcagtctcaattctcctg
gcaggaatattgtgcatatatataaactatgactgtgatcgacagcgccaagaatttcgc
cggacaaacggaaaatgctcaatctggggcaaagcaccatcaaagattgttgcttcctat
cagacaacagctggagaaaccaaaaccagtcttctcttgacttctggctggtggggcttg
tctcgtcacttccactatgttccagagatactatcagcatttttctggactgttccagct
cttttcgatcatttcctgccgtacttctatgtgatatttctgaccatattactgttggac
cgagcaaagagggatgatgatagatgctcatcaaagtacggaaagtactggaagatgtac
tgcaacaaagtaccatacagggttgttcctggtatttactga

DBGET integrated database retrieval system