KEGG   Brachypodium distachyon: 100831694Help
Entry
100831694         CDS       T01717                                 

Definition
1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bdi  Brachypodium distachyon
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bdi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 831 aa AA seqDB search
MASFAVSGATLGVVLAGSGGGGLSSTARSARAGVDLPSLLLRKKDSSSRAVLSCAGAPGK
VLVPGGGSDDLLSSAEPVSTTPAQPEESQIPEDISEQTAEASTSVDAEDKLESSEPTQGI
VETITDSVTEGVKELVVEEKPRVIQPPGDGQKIYQIDPMLEGFRSHLDYRYSEYKRIRAA
IDQYEGGLDGFSRGYEKLGFIRSAEGITYREWAPGAHSAALVGDFNNWNPNADTMTRNEY
GVWEIFLPNNADGSPAIPHGSRVKIRMDTPSGVKDSISAWIKFSVQAPGEIPYNGIYYDP
PEEEKYVFQHPQPKQPKSLRIYESHIGMSSPEPKINTYANFRDEVLPRIKRLGYNAVQIM
AIQEHSYYASFGYHVTNFFAPSSRFGTPEDLKSLIDRAHELGLLVLMDIVHSHSSNNTLD
GLNGFDGTDTHYFHGGPRGHHWMWDSRLFNYGSWEVLRFLLSNARWWLEEYKFDGFRFDG
VTSMMYTHHGLQVSFTGNYGEYFGFATDVDAVVYLMLVNDMIHGLYPDAVAIGEDVSGMP
TFCLPVQDGGVGFDYRLHMAVADKWIELLKQSDESWKMGDIVHTLTNRRWSEKCVTYAES
HDQALVGDKTIAFWLMDKDMYDFMALDRPSTPRIDRGIALHKMIRLVTMGLGGEGYLNFM
GNEFGHPEWIDFPRGPQTLPNGSVLPGNNNSYDKCRRRFDLGDADFLRYHGMQEFDQAMQ
HLEEKYGFMTSEHQYVSRKHEEDKVIIFERGDLVFVFNFHWSNSFFDYRVGCSKPGKYKV
ALDSDDVLFGGFSRLDHDVEYFTTEDPHDNRPRSFSVYTPSRTVVVYALTE
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttcgcggtgtccggcgccacgctcggggtcgtgctggccggcagcggcggc
ggagggctctcgtcgacggcgcgatcagcgcgggccggggtggacttgccgtcgctgctc
ctcaggaagaaggactcctcctctcgcgccgttctgagctgtgcgggcgctccggggaag
gtgctggtgcctggcggtggaagcgacgacttgctctcctccgccgaacctgtctcgacc
actccagcgcagcctgaagaatcacagatacctgaagacatcagcgagcaaacggccgag
gcaagcacatcagttgacgctgaagacaaacttgaatcttcagaaccaactcagggtatc
gtggaaacaatcaccgacagcgtaactgaaggagtcaaggaattagtcgtggaggagaaa
ccacgagttatccaaccaccaggagatgggcagaaaatataccagatcgacccaatgctg
gaaggatttcggagccatcttgactaccgatacagcgaatacaagagaattcgtgctgct
attgaccaatatgaaggtggtttggatggattttctcgtggttatgaaaagcttggattt
atccgcagtgctgaaggtattacttaccgagaatgggctcctggagcacattctgcagca
ttagtaggtgacttcaacaattggaatccaaatgcagatactatgaccagaaatgagtat
ggtgtttgggagattttcctccctaacaatgctgatgggtctccagctattcctcatggc
tcacgtgtaaagatacggatggatacgccatctggtgtgaaggattcaatttctgcttgg
atcaagttctctgtgcaggctccaggtgaaataccatacaatggcatatattatgatcca
ccggaagaggagaagtatgtattccaacatcctcaacctaaacaaccaaagtcactgcgg
atatatgaatcacatattggaatgagtagcccggaaccgaagataaacacatatgctaat
tttagggatgaggtgctaccaagaattaaaaggcttggatacaatgcagtacagataatg
gcaatccaggagcactcatattatgcaagctttgggtaccatgttactaatttttttgca
ccaagcagccgtttcggaactccagaggacctaaaatctttgatagatagagcacatgag
cttggtttacttgtgcttatggatattgttcacagtcattcatcaaataataccctggac
ggtctgaatggattcgatggcactgatacacattatttccatggtggtcctcggggccat
cattggatgtgggattctcgtctattcaactatgggagttgggaagttttaagattttta
ctgtcaaatgcaagatggtggcttgaagaatataaattcgatggattccgatttgatggg
gtgacctccatgatgtatactcaccatggattacaggtgtcttttactgggaactatggc
gagtattttggatttgctacggatgttgatgcggtagtttacttaatgctggtaaacgat
atgattcacggactatatcctgatgctgtagctattggtgaagatgtcagcggaatgcct
acattttgccttcctgttcaagatggtggtgttggttttgactatcgcctacatatggct
gtagcagataaatggatcgaactcctgaagcaaagtgatgaatcttggaaaatgggagat
attgtgcacactctaacaaatagaagatggtcagagaagtgcgtcacttacgcagaaagt
catgatcaagcactagttggtgacaagactattgcattctggttgatggataaggatatg
tatgatttcatggctttggacagaccttcaacacctcgcattgatcgtggcatagcatta
cataaaatgattaggcttgtcaccatgggtttagggggcgaaggctatcttaacttcatg
ggaaatgagtttgggcatcctgaatggatagattttccaagaggtccccaaactcttcca
aacggctcggtcctccctggaaacaacaatagttatgataagtgccgccgtagattcgac
cttggagatgcggattttctcagatatcatggtatgcaagagtttgatcaggcaatgcag
catcttgaagaaaaatatggattcatgacatctgagcaccagtatgtttcacggaaacat
gaggaagataaggtgatcatcttcgagagaggagatttggtatttgttttcaacttccac
tggagcaatagcttttttgactaccgtgttggttgttccaagcctgggaagtacaaggtg
gccttagactctgacgacgttctctttggtggattcagtaggcttgatcatgacgtcgag
tacttcacaactgaagatccacatgacaacaggccgcgatctttctcggtgtacacaccg
agcagaactgtcgtcgtgtatgcccttacagagtag

DBGET integrated database retrieval system