KEGG   Brachypodium distachyon: 100831836Help
Entry
100831836         CDS       T01717                                 

Definition
putative pectinesterase 11-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bdi00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bdi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 326 aa AA seqDB search
MLNNRVNTPPRAETAAAATLLSLLCFCSAISSSAGSSGMSGSIILLAVDQSGKGDHRRIQ
DADNAAPANNSAGTVIRIKPGVYRQKVMVDKPYITLAGTSANTTVITRNDAWVSDDSPTV
SVLASDFVAKRLTFQNTSGSSAAAVAMRVAGDRAAFYGCSFLSFQDTLLDDTGRHYYRGC
YVEGGTDFVFGNGKALFDKCHLHLTSRIGGAFTAQQRASESEDTGFSFVGCKLTGVGVRT
SILGRPWGPYSRVVFGLSYMSSTVSPQGWDDWGDHHRQRTAFYGQYQCYGQGSKTDDRVX
WSRELSQAEAAPFITKAWVGGQQWLR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataatcgcgtcaacacgccgcccagggcagaaactgcagcagcagcgactcta
ctgtctctgctctgcttttgctctgccatctcttcctctgccggctccagcggcatgtcg
ggctcgataattctccttgctgttgaccagtccggcaaaggcgaccacaggaggatccag
gacgcggacaatgccgccccggcgaacaactctgccggcaccgtcatacggatcaagccg
ggggtttacaggcaaaaggtcatggtggacaagccctacataacactggccggaacgagc
gccaacacgaccgtcatcacccggaatgacgcctgggtctccgacgactccccgaccgtc
tccgtgctggcctccgacttcgtcgccaagcgcttaacgtttcagaacacgtccgggagc
agcgcggcggcggtcgcgatgagggtcgcaggggacagagcggcgttctacgggtgcagt
ttcctgtcgttccaggacacgctcctggacgacacgggccgccattactaccgcgggtgc
tacgtagaaggaggaactgacttcgtcttcggaaacggcaaggctctttttgataaatgc
cacctgcacttgacctcgcgcataggcggcgcgttcacggcgcagcagcgggcgtcggag
tcagaggacacggggttcagcttcgtcggctgcaagctgaccggcgtcggggtcaggacg
tccatcttgggacgcccatggggcccgtactcgcgtgtcgtcttcggtctcagttacatg
tccagcacggtgagcccccaaggatgggacgactggggcgaccaccacaggcagaggacg
gcattctatgggcagtaccaatgttacggccaaggatcgaaaactgatgacagagttncg
tggtctcgcgagctctcgcaagctgaagcggcacctttcatcaccaaggcttgggttgga
ggacaacaatggcttcggtag

DBGET integrated database retrieval system