KEGG   Brachypodium distachyon: 100831836Help
Entry
100831836         CDS       T01717                                 

Definition
(RefSeq) putative pectinesterase 11
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00040  Pentose and glucuronate interconversions
bdi01100  Metabolic pathways
Module
bdi_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100831836
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     100831836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase Adeno_E1B_55K
Motif
Other DBs
NCBI-GeneID: 100831836
NCBI-ProteinID: XP_024314130
Position
2
AA seq 328 aa AA seqDB search
MLNNRVNTPPRAETAAAATLLSLLCFCSAISSSAGSSGMSGSIILLAVDQSGKGDHRRIQ
DADNAAPANNSAGTVIRIKPGVYREKVMVDKPYITLAGTSANTTVITRNDAWVSDDSPTV
SVLASDFVAKRLTFQNTSGSSAAAVAMRVAGDRAAFYGCSFLSFQDTLLDDTGRHYYRGC
YVEGGTDFVFGNGKALFDKCHLHLTSRIGGAFTAQQRASESEDTGFSFVGCKLTGVGVRT
SILGRPWGPYSRVVFGLSYMSSTVSPQGWDDWGDHHRQRTAFYGQYQCYGQGSKTDDRVR
GLASSRKLKRHLSSPRLGLEDNNGFGRK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataatcgcgtcaacacgccgcccagggcagaaactgcagcagcagcgactcta
ctgtctctgctctgcttttgctctgccatctcttcctctgccggctccagcggcatgtcg
ggctcgataattctccttgctgttgaccagtccggcaaaggcgaccacaggaggatccag
gacgcggacaatgccgccccggcgaacaactctgccggcaccgtcatacggatcaagccg
ggggtttacagggagaaggtcatggtggacaagccctacataacactggccggaacgagc
gccaacacgaccgtcatcacccggaatgacgcctgggtctccgacgactccccgaccgtc
tccgtgctggcctccgacttcgtcgccaagcgcttaacgtttcagaacacgtccgggagc
agcgcggcggcggtcgcgatgagggtcgcaggggacagagcggcgttctacgggtgcagt
ttcctgtcgttccaggacacgctcctggacgacacgggccgccattactaccgcgggtgc
tacgtagaaggaggaactgacttcgtcttcggaaacggcaaggctctttttgataaatgc
cacctgcacttgacctcgcgcataggcggcgcgttcacggcgcagcagcgggcgtcggag
tcagaggacacggggttcagcttcgtcggctgcaagctgaccggcgtcggggtcaggacg
tccatcttgggacgcccatggggcccgtactcgcgtgtcgtcttcggtctcagttacatg
tccagcacggtgagcccccaaggatgggacgactggggcgaccaccacaggcagaggacg
gcattctatgggcagtaccaatgttacggccaaggatcgaaaactgatgacagagttcgt
ggtctcgcgagctctcgcaagctgaagcggcacctttcatcaccaaggcttgggttggag
gacaacaatggcttcggtagaaaatag

DBGET integrated database retrieval system