KEGG   Brachypodium distachyon: 100831836Help
Entry
100831836         CDS       T01717                                 

Definition
putative pectinesterase 11-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100831836
   00500 Starch and sucrose metabolism
    100831836
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     100831836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 326 aa AA seqDB search
MLNNRVNTPPRAETAAAATLLSLLCFCSAISSSAGSSGMSGSIILLAVDQSGKGDHRRIQ
DADNAAPANNSAGTVIRIKPGVYRQKVMVDKPYITLAGTSANTTVITRNDAWVSDDSPTV
SVLASDFVAKRLTFQNTSGSSAAAVAMRVAGDRAAFYGCSFLSFQDTLLDDTGRHYYRGC
YVEGGTDFVFGNGKALFDKCHLHLTSRIGGAFTAQQRASESEDTGFSFVGCKLTGVGVRT
SILGRPWGPYSRVVFGLSYMSSTVSPQGWDDWGDHHRQRTAFYGQYQCYGQGSKTDDRVX
WSRELSQAEAAPFITKAWVGGQQWLR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataatcgcgtcaacacgccgcccagggcagaaactgcagcagcagcgactcta
ctgtctctgctctgcttttgctctgccatctcttcctctgccggctccagcggcatgtcg
ggctcgataattctccttgctgttgaccagtccggcaaaggcgaccacaggaggatccag
gacgcggacaatgccgccccggcgaacaactctgccggcaccgtcatacggatcaagccg
ggggtttacaggcaaaaggtcatggtggacaagccctacataacactggccggaacgagc
gccaacacgaccgtcatcacccggaatgacgcctgggtctccgacgactccccgaccgtc
tccgtgctggcctccgacttcgtcgccaagcgcttaacgtttcagaacacgtccgggagc
agcgcggcggcggtcgcgatgagggtcgcaggggacagagcggcgttctacgggtgcagt
ttcctgtcgttccaggacacgctcctggacgacacgggccgccattactaccgcgggtgc
tacgtagaaggaggaactgacttcgtcttcggaaacggcaaggctctttttgataaatgc
cacctgcacttgacctcgcgcataggcggcgcgttcacggcgcagcagcgggcgtcggag
tcagaggacacggggttcagcttcgtcggctgcaagctgaccggcgtcggggtcaggacg
tccatcttgggacgcccatggggcccgtactcgcgtgtcgtcttcggtctcagttacatg
tccagcacggtgagcccccaaggatgggacgactggggcgaccaccacaggcagaggacg
gcattctatgggcagtaccaatgttacggccaaggatcgaaaactgatgacagagttncg
tggtctcgcgagctctcgcaagctgaagcggcacctttcatcaccaaggcttgggttgga
ggacaacaatggcttcggtag

DBGET integrated database retrieval system