KEGG   Brachypodium distachyon: 100831891Help
Entry
100831891         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 12-like
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100831891
Peptidases [BR:bdi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100831891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1118 aa AA seqDB search
MTTTTPAPLEQEDEEMLVPHQEVAAVAADAAQPMEVVAQTEAVSTADSQPPEDPQTSRFT
WTIQNFTRLIGKKHYSDVFVVGGYKWRVLIFPKGNNVEHLSMYLDVADSANLPYGWSRSA
QFSLAIVNQIDQKYTTRKDTQHQFSARESDWGFTSFMPLSELYEPSRGYLVNDTIVVEAE
VAVRKMVDYWTYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMP
SGSIPLALQSLFYKLQYSDNSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMK
GTVVEGTIEQLFEGHHINYIECINVDYKSNRKESFYDLQLDVKGCRDVYASFDKYVEVER
LEGDNKYHAENHGLQDAKKGVLFLDFPPVLQLQLKRFEYDYMRDTMVKINDRYEFPLQLD
LDRDDGKYLAPDADRSIRNLYTLHSVLVHSGGVHGGHYYAFIRPTLADQWYKFDDERVTK
EDTKKAFEEQYGGEEELPQINPGFNNTPFKFTKYSNAYMLVYIRESDKEKIMCNVDEKDI
AEHLRIRLKKEQEEKEHKKKEKAEAHLYTIIKIARDEDLKEQTGKDIYFDLVDHEKVRSF
RIQKQLPFNTFKEEIAKEYGIPVQFQRFWLWAKRQNHTYRPNRPLTPHEETQSVGQLREI
SNKAQNAELKLFLEVEFGLDLQPLPPPEKSKEDILLFFKLYNPEKETLCFVGRLFVKALG
KPSDILRKLNEMAGFTPDEEIELYEEIKFEPNVMCEHIDKKLTFRSCQLEDGDIVCFQKS
PKADSDTQVRYPDVPSFLEYVHNRQVVHFRSLEKPKDDDFCLELSKLHTYDDVVERVARQ
LGLDDPAKIRLTSHNCYSQQPKPQPIRYRGVEHLLDMLIHYNQTSDILYYEVLDIPLPEL
QFLKTLKVAFHSATKDEVVIHSIRLPKNSTIADVINDLKTKVDLSSPSAELRLLEVFYHK
IYKIFPLHEKIENINDQYWTLRAEEIPEEEKNPSPHDRLIHVYHFTKDPLQNQIQNFGDP
FFLAIHEGETLAQVKERIKRKLQVADEEFSKWKFAFVSMNRPDYLEDSDVVSARFQRRDV
YGAWEQYLGLEHTDTAPKRAYTANQNRHTHEKPVKIYN
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgactacgacgactcccgcccctctcgagcaggaggacgaggagatgctcgtgccccac
caggaggtcgccgccgtcgccgctgacgctgcccagcccatggaagtggtggcgcagaca
gaggcggtaagcacagctgatagccagccaccggaggacccgcagacgtcccgtttcact
tggacaatccagaattttaccaggctcatcgggaagaagcactactcagatgtgtttgtc
gtcggcgggtacaaatggcgcgttcttattttccccaaggggaataacgtggagcacttg
tcaatgtacttggacgttgccgactcggctaacctcccgtatggttggagccgctccgct
caatttagcttggcaattgtgaaccagatcgatcagaagtatacgacacgaaaagatact
caacatcaatttagtgctcgcgagagcgattggggtttcacatcttttatgcctttgagt
gagctatatgagccaagtagaggataccttgtgaatgatactattgttgtggaggcagag
gttgctgtccgtaaaatggttgactattggacatatgactcaaaaaaggaaacaggttat
gttggtctgaaaaatcaaggagctacatgttatatgaattctcttctgcaaacattgtac
cacataccatacttcaggaaggctgtctatcatatgccaaccaccgaaaatgacatgcca
tctggaagtattcccttggcgctgcagagcctcttctacaagctccagtacagtgacaac
agtgtggctacaaaagagttgaccaaatcttttggatgggacacatatgattccttcatg
cagcatgatgtacaagagctcaacagagttctctgtgagaaacttgaagataagatgaag
ggaactgttgtagaaggaacaatcgaacaattatttgaaggtcaccacattaattacatc
gagtgtataaacgtggactataaatccaacaggaaggagtctttttatgaccttcaactt
gatgttaaaggttgtcgtgatgtgtatgcatcgtttgacaaatatgttgaagttgagcgt
cttgagggtgataacaagtaccatgcagagaaccatggtttacaggatgcaaaaaagggt
gttctcttcctcgatttcccccctgttttacagcttcagttgaagcgttttgagtacgac
tatatgagagataccatggttaagattaatgaccgctatgagttccctttgcaacttgat
ctggatagagatgatggcaagtatcttgctccagatgcagatagaagtataagaaacctt
tatactcttcacagtgttcttgttcatagtggaggagtacatggtggtcactattacgca
ttcatacgaccaactctagcagatcaatggtataaatttgatgatgagcgcgtaacaaaa
gaagatactaagaaggcattcgaagagcaatatggcggtgaggaagagttacctcaaata
aaccctggattcaacaacacaccatttaaattcacgaagtattcaaatgcctacatgctt
gtatacatccgtgagagtgacaaagagaaaataatgtgtaatgttgacgagaaagacatt
gctgagcatttaaggataagattgaagaaagagcaagaagagaaagaacataagaagaaa
gaaaaagctgaagctcatctctataccatcataaagatagctcgagatgaggatttgaag
gagcaaactggtaaagatatatattttgatctggtggaccatgaaaaagtccgtagcttc
cgaatacagaagcaattgccatttaatactttcaaggaggaaatagcgaaggagtatggt
atcccagtacagtttcagcgcttctggttgtgggctaaaaggcaaaaccatacataccgg
ccgaatcgtccgttgactcctcatgaagaaacacaatctgtggggcaactgagggagata
tcaaataaggcacagaatgctgagctcaagcttttcttggaagtggaatttggactggat
ctgcagcccctccctcctcctgagaagagcaaggaagatattcttctctttttcaaactc
tacaaccccgaaaaggaaacgctttgttttgtggggaggctcttcgtaaaggccttgggg
aaaccttcagatatcctgagaaaactaaatgaaatggctgggttcacgccagatgaagag
atcgagctgtacgaggaaattaagtttgagccaaatgtgatgtgcgaacatattgacaag
aaacttactttccgttcttgccagcttgaagatggggacatagtctgtttccagaaatca
cctaaagcagatagtgatactcaagtgcgctatccggatgttccttcatttttggagtat
gtgcataataggcaggttgtgcactttcggtctttggagaaacctaaggatgacgatttt
tgtttggaattgtcaaagcttcacacatatgatgatgttgttgagagagttgcccgccag
cttgggctagatgatccagcaaaaattcgtcttacatcccataactgctactcacagcag
cctaaaccgcaacccatcagatatcgaggcgtggagcatctactggacatgctcatccac
tataatcagacgtccgacatcttgtattatgaagtgttggatattccattgccggagttg
cagttcctgaaaacccttaaagttgcattccatagcgctacaaaagatgaggttgtcatt
cacagcatcaggcttcctaagaatagcaccattgctgacgtgattaatgacttgaagacc
aaggttgatctatccagtcccagtgctgaactgcgcttgctagaggtcttttaccacaag
atctataagatctttccacttcatgagaaaattgagaatataaatgatcagtactggacg
ctgcgtgctgaggagattccggaggaggagaaaaatcccagtccacacgatcgcttaatt
catgtttatcatttcactaaagatcctcttcagaatcagattcagaactttggagatcct
ttttttcttgctatccatgaaggtgagacattagcacaagtaaaggagcgcataaagaga
aaactccaagtcgctgatgaggaattctccaagtggaaatttgcattcgtgtctatgaat
cggccagactacctcgaagattcagatgttgtatctgcccgctttcagaggagagatgtc
tatggagcttgggaacaatatcttgggttggagcacactgatactgcaccaaaaagggcc
tacacagccaatcagaaccgtcacacacatgagaagccagtgaaaatttacaattga

DBGET integrated database retrieval system