KEGG   Brachypodium distachyon: 100831986Help
Entry
100831986         CDS       T01717                                 

Definition
phosphoinositide phospholipase C 4-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bdi  Brachypodium distachyon
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100831986
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100831986
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100831986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 596 aa AA seqDB search
MGTYKCCIFFTRRFALSDASTPEDVRTLFSRFSSGAPYMGVDELRRYLAATGGADGDSGG
DGDLEAAERIIDRALQGRTRTPRFGKPSLTVDDFHNFLFSEDLNPPIRHPKVHHDMSAPL
SHYFIYTGHNSYLTGNQLSSDCSDIPIIKALQIGVRVIELDMWPNSSKDDIDILHGRTLT
APVSLIKCLTSIKEYAFVASPYPVIITLEDHLTSDLQAKVAKMVLEVFGDILYYPESKHL
QEFPSPEALKGRVILSTKPPKEYLEAKGGTMKERDIQPQFKKGENEQSAWGIEVPDIQDE
MQNADKEDLLYRERDVDEDDEQKMRQHAPLEYKHLITIKAGKPKGSLVDALKSDPEKVRR
LSLSEQELAKVAARHGPNIVSFTQRNLLRIYPKGTRFNSSNYNPFLGWVHGAQMVAFNMQ
GYGRALWLMHGFYKANGGCGYVKKPDFLMQTCPDGKVFDPNADLPVKTTLKVKVYMGDGW
QNDFKQTHFDSYSPPDFYAKVGIAGVPLDSVMRKTRAVEDSWVPVWEEEFTFPLTVPEIA
LLRVEVHEYDVNEDDFGGQSVLPVSELRPGIRAMPLFDHMGMKFKSVRLLVSFEFV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggggacgtacaagtgctgcatcttcttcacgcgcaggttcgcgctcagcgacgcgtcc
acgccggaggatgtgcgcacgctcttctcccgcttctccagcggcgcgccgtacatgggc
gtcgacgagctccgccgctacctcgccgccacggggggcgccgacggcgacagcggcggc
gatggcgacctggaggcggcggagcggatcattgaccgagcccttcagggccgcacccgc
accccgcgtttcgggaagccgtccctcaccgtcgacgacttccacaacttcctcttctcc
gaggacctcaaccctcccatccgccaccccaaggtccatcacgacatgagtgcaccattg
tcccactatttcatatacactggacataactcatatcttactggcaatcaacttagcagt
gactgtagtgacattcccatcatcaaggcgctgcaaataggtgtccgtgtaattgaacta
gacatgtggcccaattcttcgaaagatgacattgatattcttcatggaaggacactgact
gccccagtatcacttatcaaatgcttgacatccatcaaagaatatgcctttgtcgcatct
ccctatcctgttattataacattagaagaccaccttacatctgatcttcaagcaaaagta
gctaagatggtcctcgaagtatttggagatatcctgtactatcctgaatcaaaacatctt
caagaatttccttcaccggaagcactaaaggggcgtgtcattctctcaacgaaaccccca
aaggagtatcttgaagcaaagggtggtactatgaaagagagagacatccagccacaattt
aaaaaaggagaaaatgaacaatcagcatggggtatagaagtccctgatattcaggatgag
atgcaaaatgctgacaaggaggatctattataccgtgaaagagatgtggatgaagatgac
gagcagaaaatgcgccaacatgcacccctagagtataaacaccttattactatcaaggca
ggaaaaccaaagggttctctagttgacgccttaaaaagtgacccagaaaaggttaggcgc
ctcagtttgagtgagcaagaacttgcaaaagtggccgcacgtcatggtcccaacatagtg
agcttcacacaaagaaatctactgagaatatacccaaaggggactcgcttcaattcatcc
aactacaatccgtttcttggctgggtgcatggggctcaaatggtggcattcaatatgcag
ggctatggaagagccctttggttgatgcatgggttttacaaagccaatggtggctgcggc
tatgtgaaaaaaccagatttcttgatgcaaacttgtccagatggaaaggttttcgacccg
aacgcagacctacctgtgaagacaacgctgaaggtcaaagtgtacatgggcgatggttgg
cagaacgactttaagcagacacattttgattcctattcccctccagatttctatgcaaag
gtgggcatcgccggagttccgttggactctgtgatgaggaagacgagggccgtggaggat
agctgggtgccggtgtgggaggaggagttcacattcccgctgaccgtcccggagatcgca
ctgctccgcgtggaggtgcacgagtacgacgtgaacgaggacgacttcggcgggcagtcc
gtgctgccggtgtcggagctgcggccggggatccgcgctatgccgctcttcgaccacatg
gggatgaagttcaagagcgtcagactcctcgtgagcttcgagttcgtctag

DBGET integrated database retrieval system