KEGG   Brachypodium distachyon: 100831999Help
Entry
100831999         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 563 aa AA seqDB search
MSTPSAPPPCPHLAAHRLTSRPLRFLRRCLRVRPLGRPEIRRDAREVPRCSPCASSTSPS
PSPPRLYACLSCAAVFCASHAASHAATPPSPGHQIAVDVDRAELFCAACGDQVYDSDFDH
AVVLAQSSTLCPASTSSASAPSPRKRRRVDYRAWAPDPAESALMSSADPATSARAAAAAA
PPGLRGLNNLGNTCFMNSVLQALLHAPPLRNYFLGDRHNRFLCPRRTPMRHRAAGADAKA
ACLACDLDEIYSATFSGERTPYSPAKFLYSWWQHASNLASYEQQDAHEFFISILDHIHEN
IKDEQHKSHEQGHGDCCIAHRVFSGILRSDVICTNCGFSSTTFEPCVDISLDLDAGSNNS
LANPKLHARNGERNLAGTNSKVSTLMRCLERFTRAERLDAEQKFFCERCKERQESLKQMS
IRRLPLVSCFHIKRFEHSSVKKMSRKVDHSLQFPFSLDMAPYLSSSVLRSRYGNRIFPSE
ASDSDAVSELSSEFEIFAVITHSGKLDAGHYVTYLRLNNLWYRCDDAWVTRVEEHTVRTS
QAYMLFYVQKTLYYKACERAGAV
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccgtccgcgccgccgccctgcccgcacctggccgcgcaccgcctgacctcg
cgcccgctccgcttcctccgccgctgcctgcgcgtgcgcccgctcggccggcccgagatc
cgccgcgacgcgcgcgaggtgccccgctgctccccttgcgcgtcctccacctccccgtcc
ccgtccccgccccgcctctacgcctgcctctcctgcgccgccgtcttctgcgcctcccac
gccgcctcccacgccgctacgcccccctccccgggccaccagatcgccgtcgacgtcgac
cgcgccgagctcttctgcgccgcctgcggggaccaggtctacgactccgacttcgaccac
gccgtcgtcctcgcccagtcctccaccctctgccccgcctccacctcctccgcctccgcc
ccctcgccccgcaagcgccgccgcgtcgactaccgcgcctgggcgccagatccggccgaa
tccgcgctcatgagctccgccgatcccgccacctccgcccgcgccgccgccgccgccgcg
ccgccggggctccgcgggctcaacaacctcggcaacacctgcttcatgaactccgtgctc
caggcgctcctccacgcgccgccgctccggaactacttcctcggcgatcgccacaatcgc
ttcctctgcccgcgccgcacgcccatgaggcaccgcgcggccggtgccgacgccaaggcc
gcctgcctcgcctgcgatctcgacgagatctactccgccaccttctccggggagcgcacg
ccctacagcccggccaagttcctctatagctggtggcagcatgcatcaaacctcgcaagc
tacgagcaacaggatgcacatgaattttttatctccatccttgaccatattcatgaaaat
ataaaggatgaacagcacaaatcacatgaacaaggccatggagactgttgtattgcacac
cgggtcttttctggtatcctgagatctgatgtcatctgcacaaattgtgggttctcatcc
acgacttttgaaccttgcgtggacatctcgttagacttggatgctgggtctaacaattct
cttgcaaacccaaagttgcatgcacgcaatggtgagaggaacttagctggcacaaattct
aaggtatcaacactcatgagatgtttggagcggtttaccagagctgagaggctagatgct
gaacagaagttcttctgtgaacgttgcaaagagaggcaggagtccctgaagcaaatgtcc
attcggaggcttccattagtttcctgctttcacattaagagatttgagcattcctcagtt
aagaagatgtcaagaaaggttgatcactcattgcagttccctttttctcttgacatggca
ccttacctgtcatcctctgttctcagaagtagatatgggaaccgcatatttccatctgaa
gccagtgattcagatgcagtttctgaattgtcatcagaattcgaaatattcgcggtgatc
acacatagtggtaaactagatgctggccactacgtgacatatctcaggttaaacaatctc
tggtacagatgtgatgatgcatgggtaaccagagttgaggagcatactgtcagaacttct
caggcttatatgctcttctatgtgcagaagacgctttactataaagcttgtgaaagagct
ggtgcagtctga

DBGET integrated database retrieval system