KEGG   Brachypodium distachyon: 100831999Help
Entry
100831999         CDS       T01717                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 22
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100831999
Peptidases [BR:bdi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100831999
Transcription machinery [BR:bdi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100831999
Ubiquitin system [BR:bdi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100831999
Chromosome [BR:bdi03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     100831999
    SLIK complex
     100831999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 563 aa AA seqDB search
MSTPSAPPPCPHLAAHRLTSRPLRFLRRCLRVRPLGRPEIRRDAREVPRCSPCASSTSPS
PSPPRLYACLSCAAVFCASHAASHAATPPSPGHQIAVDVDRAELFCAACGDQVYDSDFDH
AVVLAQSSTLCPASTSSASAPSPRKRRRVDYRAWAPDPAESALMSSADPATSARAAAAAA
PPGLRGLNNLGNTCFMNSVLQALLHAPPLRNYFLGDRHNRFLCPRRTPMRHRAAGADAKA
ACLACDLDEIYSATFSGERTPYSPAKFLYSWWQHASNLASYEQQDAHEFFISILDHIHEN
IKDEQHKSHEQGHGDCCIAHRVFSGILRSDVICTNCGFSSTTFEPCVDISLDLDAGSNNS
LANPKLHARNGERNLAGTNSKVSTLMRCLERFTRAERLDAEQKFFCERCKERQESLKQMS
IRRLPLVSCFHIKRFEHSSVKKMSRKVDHSLQFPFSLDMAPYLSSSVLRSRYGNRIFPSE
ASDSDAVSELSSEFEIFAVITHSGKLDAGHYVTYLRLNNLWYRCDDAWVTRVEEHTVRTS
QAYMLFYVQKTLYYKACERAGAV
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccgtccgcgccgccgccctgcccgcacctggccgcgcaccgcctgacctcg
cgcccgctccgcttcctccgccgctgcctgcgcgtgcgcccgctcggccggcccgagatc
cgccgcgacgcgcgcgaggtgccccgctgctccccttgcgcgtcctccacctccccgtcc
ccgtccccgccccgcctctacgcctgcctctcctgcgccgccgtcttctgcgcctcccac
gccgcctcccacgccgctacgcccccctccccgggccaccagatcgccgtcgacgtcgac
cgcgccgagctcttctgcgccgcctgcggggaccaggtctacgactccgacttcgaccac
gccgtcgtcctcgcccagtcctccaccctctgccccgcctccacctcctccgcctccgcc
ccctcgccccgcaagcgccgccgcgtcgactaccgcgcctgggcgccagatccggccgaa
tccgcgctcatgagctccgccgatcccgccacctccgcccgcgccgccgccgccgccgcg
ccgccggggctccgcgggctcaacaacctcggcaacacctgcttcatgaactccgtgctc
caggcgctcctccacgcgccgccgctccggaactacttcctcggcgatcgccacaatcgc
ttcctctgcccgcgccgcacgcccatgaggcaccgcgcggccggtgccgacgccaaggcc
gcctgcctcgcctgcgatctcgacgagatctactccgccaccttctccggggagcgcacg
ccctacagcccggccaagttcctctatagctggtggcagcatgcatcaaacctcgcaagc
tacgagcaacaggatgcacatgaattttttatctccatccttgaccatattcatgaaaat
ataaaggatgaacagcacaaatcacatgaacaaggccatggagactgttgtattgcacac
cgggtcttttctggtatcctgagatctgatgtcatctgcacaaattgtgggttctcatcc
acgacttttgaaccttgcgtggacatctcgttagacttggatgctgggtctaacaattct
cttgcaaacccaaagttgcatgcacgcaatggtgagaggaacttagctggcacaaattct
aaggtatcaacactcatgagatgtttggagcggtttaccagagctgagaggctagatgct
gaacagaagttcttctgtgaacgttgcaaagagaggcaggagtccctgaagcaaatgtcc
attcggaggcttccattagtttcctgctttcacattaagagatttgagcattcctcagtt
aagaagatgtcaagaaaggttgatcactcattgcagttccctttttctcttgacatggca
ccttacctgtcatcctctgttctcagaagtagatatgggaaccgcatatttccatctgaa
gccagtgattcagatgcagtttctgaattgtcatcagaattcgaaatattcgcggtgatc
acacatagtggtaaactagatgctggccactacgtgacatatctcaggttaaacaatctc
tggtacagatgtgatgatgcatgggtaaccagagttgaggagcatactgtcagaacttct
caggcttatatgctcttctatgtgcagaagacgctttactataaagcttgtgaaagagct
ggtgcagtctga

DBGET integrated database retrieval system