KEGG   Brachypodium distachyon: 100832579Help
Entry
100832579         CDS       T01717                                 

Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00260  Glycine, serine and threonine metabolism
bdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01230  Biosynthesis of amino acids
Module
bdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100832579
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100832579
Enzymes [BR:bdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100832579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB FMN_dh NanE TMP-TENI IGPS Ribul_P_3_epim
Motif
Other DBs
NCBI-GeneID: 100832579
NCBI-ProteinID: XP_003557476
UniProt: I1H330
Position
1
AA seq 331 aa AA seqDB search
MAFALKASSSSSVAASSAAASSASFAASAAPRGRRAAPRRVSFRGAAPMVAIRAEASATA
APVAGDRLTISGTFSKLKEQGKIAFIPFIVAGDPDLATTAKALKVLDACGSDVIELGVPY
SDPLADGPVIQASATRALTKGTTFEDVISMVKEVVPSLSCPLALFTYYNPILKRGVANFM
SVVKEAGVHGLVVPDVPLEETDILRSEAAKNNLELVLLTTPTTPTERMERITKASEGFVY
LVSTTGVTGARSNVSFKVEALLQEIKQVTDKAVAVGFGVSTPEQVKQIAGWGADGVIVGS
AMVRQLGESGSPEEGLKKLEELAKNLKAAFP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgcgctcaaggcctcctcgtcctcctccgtcgccgcttcctcggcggcggcg
tcgtcggcctcgttcgccgcctccgcggcgccaagggggcgccgcgccgcgccgaggagg
gtctcgttccgcggggccgcgcccatggtcgccatcagggcggaggcgtcagccaccgcc
gccccggtggccggggacaggctcaccatctcgggcaccttctccaagctgaaggagcag
ggcaagattgcattcattccattcatcgttgctggtgaccctgacttggcaactacagcg
aaagcattgaaggttcttgatgcgtgtggttcagatgtgattgaattgggtgtgccttat
tctgatccattggctgatggccctgttattcaggcttccgctacacgtgcgctaacaaaa
ggcaccacatttgaggatgttatctctatggtaaaggaggtggtacctagtctgtcctgc
cccctggcgcttttcacatattataacccaattttgaagcgtggtgtggcaaatttcatg
tctgttgtaaaagaagctggtgtgcatggtcttgtggtacctgatgttcctctggaagag
acagatattttgagaagcgaggctgccaagaacaacctagagttggtgctactgacaaca
ccaactacaccaaccgaaaggatggagaggatcacaaaggcttcagaaggatttgtttat
cttgtaagcactactggagttacaggtgcacgctcgaacgtaagtttcaaggttgaagct
cttcttcaggaaatcaagcaggtcacagacaaagctgtggctgttggctttggtgtgtca
actccagagcaagtgaagcagatcgcaggatggggtgcagatggtgtgatcgttgggagt
gcaatggtgaggcagttgggtgaatctggttctccagaagaaggattgaagaaactagaa
gaattagccaagaacctaaaggccgcatttccatga

DBGET integrated database retrieval system