KEGG   Brachypodium distachyon: 100832579Help
Entry
100832579         CDS       T01717                                 

Definition
indole-3-glycerol phosphate lyase, chloroplastic-like
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bdi  Brachypodium distachyon
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bdi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bdi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bdi00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 331 aa AA seqDB search
MAFALKASSSSSVAASSAAASSASFAASAAPRGRRAAPRRVSFRGAAPMVAIRAEASATA
APVAGDRLTISGTFSKLKEQGKIAFIPFIVAGDPDLATTAKALKVLDACGSDVIELGVPY
SDPLADGPVIQASATRALTKGTTFEDVISMVKEVVPSLSCPLALFTYYNPILKRGVANFM
SVVKEAGVHGLVVPDVPLEETDILRSEAAKNNLELVLLTTPTTPTERMERITKASEGFVY
LVSTTGVTGARSNVSFKVEALLQEIKQVTDKAVAVGFGVSTPEQVKQIAGWGADGVIVGS
AMVRQLGESGSPEEGLKKLEELAKNLKAAFP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgcgctcaaggcctcctcgtcctcctccgtcgccgcttcctcggcggcggcg
tcgtcggcctcgttcgccgcctccgcggcgccaagggggcgccgcgccgcgccgaggagg
gtctcgttccgcggggccgcgcccatggtcgccatcagggcggaggcgtcagccaccgcc
gccccggtggccggggacaggctcaccatctcgggcaccttctccaagctgaaggagcag
ggcaagattgcattcattccattcatcgttgctggtgaccctgacttggcaactacagcg
aaagcattgaaggttcttgatgcgtgtggttcagatgtgattgaattgggtgtgccttat
tctgatccattggctgatggccctgttattcaggcttccgctacacgtgcgctaacaaaa
ggcaccacatttgaggatgttatctctatggtaaaggaggtggtacctagtctgtcctgc
cccctggcgcttttcacatattataacccaattttgaagcgtggtgtggcaaatttcatg
tctgttgtaaaagaagctggtgtgcatggtcttgtggtacctgatgttcctctggaagag
acagatattttgagaagcgaggctgccaagaacaacctagagttggtgctactgacaaca
ccaactacaccaaccgaaaggatggagaggatcacaaaggcttcagaaggatttgtttat
cttgtaagcactactggagttacaggtgcacgctcgaacgtaagtttcaaggttgaagct
cttcttcaggaaatcaagcaggtcacagacaaagctgtggctgttggctttggtgtgtca
actccagagcaagtgaagcagatcgcaggatggggtgcagatggtgtgatcgttgggagt
gcaatggtgaggcagttgggtgaatctggttctccagaagaaggattgaagaaactagaa
gaattagccaagaacctaaaggccgcatttccatga

DBGET integrated database retrieval system