KEGG   Brachypodium distachyon: 100832659Help
Entry
100832659         CDS       T01717                                 

Definition
alcohol dehydrogenase-like 3-like
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bdi01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bdi00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bdi00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bdi00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 396 aa AA seqDB search
MEAANGFSNGGSTQGKPIKCKAAVAWGPGEPLVMEEVEVAPPAPMEVRVKVLFTSICHTD
LSFWKGENERQRKFPRILGHEAAGVIESVGEGVKDLAPGDHVVPIFTGECGTCAYCESSK
TNLCGTYRVNPFKSTMVSDNGTRFSVVDRSSGAPQPVYHFLNTSTFAEYTVLDSACAVKI
NPQAPLEKMCLLSCGISTGVGAAWNTANVSKESTVAVFGLGAVGLAVAEGARIRGAARII
GVDINPDKFTKGKEMGVTDFIESKACGKPVHELIRDMTGGGVDCSFECTGIVDVLREAFL
STHDGWGLTVALGIHPTPRMLPLHPMELFDGRRITGCVFGDFKGKSQLPLLVDQCINGEV
KINFDGFITHEMPFSEINEAFRLLEEGKSLRCVLRL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgccaatggtttctccaacggcggaagcacccaaggaaagcccatcaaatgc
aaagcggccgtggcgtggggtcccggcgagccgctggtgatggaggaggtggaggtggcg
ccgccggcgcccatggaggtgcgcgtcaaggtgctcttcacctccatctgccacaccgat
ctcagcttctggaagggagagaacgagcgtcaacgcaagtttcctcgcatcctggggcac
gaggcagccggagtgattgagagtgtgggcgaaggagtgaaggaccttgcacctggagat
cacgtggtccccatcttcacaggtgagtgcgggacatgcgcctattgtgagtccagcaag
accaacctgtgtgggacctatcgcgtcaaccctttcaagagcaccatggtctccgacaac
ggcacaaggttctccgtggtagaccggtcgagcggcgcacctcaacccgtgtaccacttc
ctcaacacctccacgttcgccgagtacacggtgctcgactctgcctgcgctgtcaagatc
aacccccaggctcctcttgagaaaatgtgtcttctcagctgcggcatctccacgggagtg
ggagccgcatggaacactgcaaacgtgtccaaggaatccaccgtggctgtattcgggctt
ggagccgttggtctcgcggttgctgaaggcgcaaggatcagaggggcagctcgcatcatc
ggcgtggacattaaccctgacaagttcaccaaaggcaaggagatgggcgtcaccgatttc
atcgagtccaaggcgtgtgggaagcccgtccacgagcttatcagggacatgacgggtggg
ggcgtcgactgcagcttcgagtgcaccggcatcgttgacgtgctccgggaggcctttctc
tccacacatgacggctggggcctgaccgtggcgctggggatccatccgacgcccaggatg
ctgccgctgcacccgatggagctcttcgacggccgtcggatcaccggctgcgtcttcggc
gacttcaagggcaagtcgcagctccccctcctcgtcgaccagtgcatcaacggggaggtg
aagataaacttcgacgggttcataacccacgagatgccattctcggagatcaacgaggct
ttccggctgctggaggagggcaagtctctccggtgtgtgctccgtctgtga

DBGET integrated database retrieval system