KEGG   Brachypodium distachyon: 100832659Help
Entry
100832659         CDS       T01717                                 

Definition
alcohol dehydrogenase-like 3-like
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    100832659
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100832659
  Lipid metabolism
   00071 Fatty acid degradation
    100832659
  Amino acid metabolism
   00350 Tyrosine metabolism
    100832659
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100832659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 396 aa AA seqDB search
MEAANGFSNGGSTQGKPIKCKAAVAWGPGEPLVMEEVEVAPPAPMEVRVKVLFTSICHTD
LSFWKGENERQRKFPRILGHEAAGVIESVGEGVKDLAPGDHVVPIFTGECGTCAYCESSK
TNLCGTYRVNPFKSTMVSDNGTRFSVVDRSSGAPQPVYHFLNTSTFAEYTVLDSACAVKI
NPQAPLEKMCLLSCGISTGVGAAWNTANVSKESTVAVFGLGAVGLAVAEGARIRGAARII
GVDINPDKFTKGKEMGVTDFIESKACGKPVHELIRDMTGGGVDCSFECTGIVDVLREAFL
STHDGWGLTVALGIHPTPRMLPLHPMELFDGRRITGCVFGDFKGKSQLPLLVDQCINGEV
KINFDGFITHEMPFSEINEAFRLLEEGKSLRCVLRL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgccaatggtttctccaacggcggaagcacccaaggaaagcccatcaaatgc
aaagcggccgtggcgtggggtcccggcgagccgctggtgatggaggaggtggaggtggcg
ccgccggcgcccatggaggtgcgcgtcaaggtgctcttcacctccatctgccacaccgat
ctcagcttctggaagggagagaacgagcgtcaacgcaagtttcctcgcatcctggggcac
gaggcagccggagtgattgagagtgtgggcgaaggagtgaaggaccttgcacctggagat
cacgtggtccccatcttcacaggtgagtgcgggacatgcgcctattgtgagtccagcaag
accaacctgtgtgggacctatcgcgtcaaccctttcaagagcaccatggtctccgacaac
ggcacaaggttctccgtggtagaccggtcgagcggcgcacctcaacccgtgtaccacttc
ctcaacacctccacgttcgccgagtacacggtgctcgactctgcctgcgctgtcaagatc
aacccccaggctcctcttgagaaaatgtgtcttctcagctgcggcatctccacgggagtg
ggagccgcatggaacactgcaaacgtgtccaaggaatccaccgtggctgtattcgggctt
ggagccgttggtctcgcggttgctgaaggcgcaaggatcagaggggcagctcgcatcatc
ggcgtggacattaaccctgacaagttcaccaaaggcaaggagatgggcgtcaccgatttc
atcgagtccaaggcgtgtgggaagcccgtccacgagcttatcagggacatgacgggtggg
ggcgtcgactgcagcttcgagtgcaccggcatcgttgacgtgctccgggaggcctttctc
tccacacatgacggctggggcctgaccgtggcgctggggatccatccgacgcccaggatg
ctgccgctgcacccgatggagctcttcgacggccgtcggatcaccggctgcgtcttcggc
gacttcaagggcaagtcgcagctccccctcctcgtcgaccagtgcatcaacggggaggtg
aagataaacttcgacgggttcataacccacgagatgccattctcggagatcaacgaggct
ttccggctgctggaggagggcaagtctctccggtgtgtgctccgtctgtga

DBGET integrated database retrieval system