KEGG   Brachypodium distachyon: 100832825Help
Entry
100832825         CDS       T01717                                 

Definition
histone deacetylase 9-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 430 aa AA seqDB search
MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHKKMEIYRPHKAYPTEL
AQFHSADYVEFLHRITPDTQHLYASELTRYNLGEDCPVFDDLFEFCQIYAGGTLDAARRL
NHKTCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHSRVLYIDIDVHHGDGVE
EAFYFTDRVMTVSFHKYGDMFFPGTGDIKDIGDREGKYYAINIPLKDGIDDTSFTRLFKT
IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFKIPLLVTGGGGY
TKENVARCWAVETGVLLDTDLPNEIPDNEYIKYFGPDYTLKVPNLNMDNLNSKTYLSSIK
VQVMESLRAIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQVHRDDEYYEGD
NDNDHDDGAH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctagagaaagacagaatatcctatttctacgatggggatgtgggaaatgtgtacttt
gggccaaatcacccgatgaaaccacatcgtctgtgtatgacacatcatcttgtcctttct
tatggacttcacaagaagatggagatatatagaccccacaaagcatatccaacagagctt
gcccagttccattctgctgattatgtggaattcttgcacaggataactcctgatacccag
cacctgtatgcaagtgaattaactagatataatcttggagaagactgcccggtatttgat
gatttgtttgagttctgccaaatttatgctggaggaactctagatgcggctcgaagacta
aaccacaaaacatgtgatattgctataaattgggctggtggtttgcatcatgcaaagaag
tgtgaggcatcaggcttctgctacattaatgacctggttttgggaattctggagcttctc
aagtatcattccagggttctctatattgacatcgacgttcatcatggagatggagttgaa
gaagccttctatttcactgacagggtaatgactgtaagtttccacaagtatggtgacatg
ttctttcctggcacaggtgatattaaggacataggagacagggaaggaaaatattatgcc
atcaacatcccacttaaagatggcatagatgacacgagctttactcggctttttaaaacg
attattgccaaggttgttgagacatatctaccaggtgctattgttcttcaatgtggcgcc
gattcattggcacgggaccgtctagggtgtttcaatctttccattgaaggccatgctgaa
tgcgtaaagtttgtcaagaaatttaaaattcccctgctggtgacgggaggtggtggatac
accaaagagaacgtagcacgctgttgggcagttgaaactggggtccttttagacacagac
ctcccaaatgagattcctgacaatgaatatattaagtactttggtccagattatacattg
aaagtaccaaatttgaacatggacaacttgaatagtaagacctatctcagttcaatcaaa
gtgcaagtcatggagagtttgcgggccatacagcatgcacctggcgttcagatgcaagag
gttccacctgatttctatatccctgattttgatgaagatgagctggatcctgatgaacgt
gttgaccagcatacccaggacaagcaggttcaccgtgacgacgagtactatgaaggtgac
aacgacaatgatcatgacgatggtgcacactga

DBGET integrated database retrieval system