KEGG   Brachypodium distachyon: 100832826Help
Entry
100832826         CDS       T01717                                 

Definition
(RefSeq) phosphoribosylglycinamide formyltransferase, chloroplastic
  KO
K00601  phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00230  Purine metabolism
bdi00670  One carbon pool by folate
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Module
bdi_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100832826
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100832826
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     100832826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Formyl_trans_N DUF4129
Motif
Other DBs
NCBI-GeneID: 100832826
NCBI-ProteinID: XP_003579770
UniProt: I1IXT9
Position
5
AA seq 292 aa AA seqDB search
MAAAAAAAPAGPNLRRPLNPVLATRPTTSPGLRSATKNPANALRCKRLRPPEPRVYANAA
TKDGYSGGGDAGAGGVRRKRLAVFVSGGGSNYRAIHEATLSGVVRGDVVALVTDKPGCGG
AEHARSNGVPVVVFPKSKSATEGVSVSELLNTMRDLGVDFVLLAGYLKLIPAELVREYPR
SILNIHPSLLPAFGGKGYYGLKVHKAAIASGARYSGPTVHFVDEHYDTGKTLAQRVVPVL
ANDTPEELAARVLHEEHQVYVEAVAALCDDRIVWREDGVPLIRNRSNPDEYT
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggctccagccggtccaaacctgcgccgtccgctgaacccg
gtgctggccacgcgaccaaccacaagtcctggattgcgatcggcgacaaagaatccagca
aacgcactcaggtgcaagcggctgcggcctccggagccgcgcgtctatgctaacgcggcg
acaaaggacggatatagcgggggcggtgacgccggcgccgggggtgtcaggaggaagcgg
ctggcggtgttcgtgtccggcgggggctccaactaccgggccatccacgaggccacgttg
agcggcgtggtgcgcggagacgtggttgctcttgtcacagacaagccaggttgtggaggc
gctgagcacgcgaggagcaatggcgttcctgtggtggtgtttcccaaatccaagtctgca
acggagggggtttcagtatctgaactgctgaataccatgagggaccttggggtagacttt
gttcttctagctggttacttgaaacttatacctgctgagttggttcgtgaatatccaaga
tccatactgaatatccatccttccctccttccagcatttggaggcaaaggttattatggt
ttaaaggtgcataaagcagccattgcctctggagcaagatactcaggtccaactgtacac
tttgtggatgagcactatgacacaggaaaaacattagcccagagggttgtgcctgtacta
gccaatgacacaccagaggagttagctgcgagagtccttcacgaggagcatcaagtttat
gttgaggcggttgctgctttgtgtgatgaccgtattgtgtggcgagaagatggtgtccca
cttatcagaaaccggtcaaatcctgatgagtatacctaa

DBGET integrated database retrieval system