KEGG   Brachypodium distachyon: 100832826Help
Entry
100832826         CDS       T01717                                 

Definition
phosphoribosylglycinamide formyltransferase, chloroplastic-like
Orthology
K00601  
phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
bdi  Brachypodium distachyon
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bdi00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bdi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 292 aa AA seqDB search
MAAAAAAAPAGPNLRRPLNPVLATRPTTSPGLRSATKNPANALRCKRLRPPEPRVYANAA
TKDGYSGGGDAGAGGVRRKRLAVFVSGGGSNYRAIHEATLSGVVRGDVVALVTDKPGCGG
AEHARSNGVPVVVFPKSKSATEGVSVSELLNTMRDLGVDFVLLAGYLKLIPAELVREYPR
SILNIHPSLLPAFGGKGYYGLKVHKAAIASGARYSGPTVHFVDEHYDTGKTLAQRVVPVL
ANDTPEELAARVLHEEHQVYVEAVAALCDDRIVWREDGVPLIRNRSNPDEYT
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggctccagccggtccaaacctgcgccgtccgctgaacccg
gtgctggccacgcgaccaaccacaagtcctggattgcgatcggcgacaaagaatccagca
aacgcactcaggtgcaagcggctgcggcctccggagccgcgcgtctatgctaacgcggcg
acaaaggacggatatagcgggggcggtgacgccggcgccgggggtgtcaggaggaagcgg
ctggcggtgttcgtgtccggcgggggctccaactaccgggccatccacgaggccacgttg
agcggcgtggtgcgcggagacgtggttgctcttgtcacagacaagccaggttgtggaggc
gctgagcacgcgaggagcaatggcgttcctgtggtggtgtttcccaaatccaagtctgca
acggagggggtttcagtatctgaactgctgaataccatgagggaccttggggtagacttt
gttcttctagctggttacttgaaacttatacctgctgagttggttcgtgaatatccaaga
tccatactgaatatccatccttccctccttccagcatttggaggcaaaggttattatggt
ttaaaggtgcataaagcagccattgcctctggagcaagatactcaggtccaactgtacac
tttgtggatgagcactatgacacaggaaaaacattagcccagagggttgtgcctgtacta
gccaatgacacaccagaggagttagctgcgagagtccttcacgaggagcatcaagtttat
gttgaggcggttgctgctttgtgtgatgaccgtattgtgtggcgagaagatggtgtccca
cttatcagaaaccggtcaaatcctgatgagtatacctaa

DBGET integrated database retrieval system