KEGG   Brachypodium distachyon: 100832973Help
Entry
100832973         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2-like
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 773 aa AA seqDB search
MGEDKRQVTTVEEEAAAEAAAKSPRKSPRLTAAVVPLAAVPLAAVSPESSESPSTQLDSS
ESTCSDDSQEHQHMFMTDEELAAIANNFKTAKEHPMCQHDDCKVTWKGASDGGGEDAGMM
LCTECGCHFCTGPVGDMLNPRGHAYWHAHEAMHRVALWYDDPYKAYCFDCEEGLTLGGNS
SQDKDAWAVVAKNGKDQWGSEDVGGHASGVAYVYGDGYVIRGILNLGSSCYMNASLQCLL
ALRKLRRMILGLDAWLGFTGHYLKELFVETGSANDATCLLNPRMLLDCVGGSGQQFKGNE
MEDTYEFLVSLRNALDKEVKELNDLNCVQGGAVLPEFGESIFRVQMCQTISCKSCPNNSV
QQIELYDLQAPVALPSKDPLARSVVSSPKIESHMSPRNICKKLFQETQKSDGEKLQTIAE
GCELGDGAMEKKPEPLQVDSTEMKDVVDDRLQTHENDGPREIVEVSIKALDFIPNLFDGI
EGVEIADSRNPKDIVPPLFTTEDKGKAQSSDIIPPIVSTEDKGKAKSCDIIPPLVITEDM
GKAQSSDIIHDVAEHMNSLSSIEDCLALLLIEQPVEWTCENCSNVAELRRTNSSKNGEQM
MGSTNVNTTVGGDQTEQDQGRGKQVKLDDHSVKQVDKDQNEQKNEDGGATQTILLTKLPP
VLTIQLKRSAADLSKLVGHVSFNEILHVGPFMDPSCEDKDNSSYRLVGVIEHIGSTLRGG
HYIAYVRADRNQQSGSSSWVCANDSSIREVSLQEVLRCEAYILFYERMEEEDD
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgggagaggacaagaggcaggttacgacggtggaggaggaggcggccgcggaggcggcg
gccaagagcccgcggaaatccccgcgcctgaccgcggccgtggtgccgctggccgcggtg
cccctggccgcggtgtcgccggaatcgagcgaatcgccatcgacacagctggattctagc
gagtccacatgttctgatgacagccaggagcaccagcacatgttcatgaccgacgaggag
ctggctgcgatcgcgaataacttcaagaccgccaaggagcacccgatgtgccagcatgac
gactgcaaggtcacctggaagggagcctctgatggcggcggtgaggacgccgggatgatg
ctatgcacggagtgcggctgtcatttctgtactgggccggtgggggacatgctaaatccg
agggggcacgcgtactggcacgcccatgaagccatgcaccgtgttgctctgtggtacgat
gatccgtataaggcatactgcttcgattgtgaagaaggtctgacgctcggtgggaacagc
tcccaggacaaagatgcgtgggcagtggttgccaaaaatggaaaggatcagtggggaagc
gaagatgtaggtggccatgcatctggggttgcttatgtttatggggatggatatgttatc
agagggattctaaatcttggaagctcatgctacatgaatgcatcgctgcagtgcctcctt
gcgcttcgtaagctgaggagaatgattttaggactggatgcttggttggggttcactgga
cattacctgaaggagttgtttgttgagacaggcagtgcaaatgatgccacatgcttgcta
aatccacgtatgctattggattgtgtggggggatctggccagcagttcaagggcaacgag
atggaagacacctacgagtttcttgtgtctttgcgcaatgctttagataaggaggtgaag
gagctaaacgatttgaattgcgtgcaagggggtgcagtgttgcctgaatttggcgaatcc
attttcagggtccagatgtgtcaaaccatatcctgcaaaagttgcccgaataattcagtt
caacaaattgagttatatgatctccaggcacctgtggcattgccatcaaaggatccacta
gcaagaagtgttgtgtcatcaccaaagatcgagagccacatgtctccaaggaatatttgc
aagaaactatttcaagaaactcaaaagagtgatggagaaaagcttcaaacaattgctgaa
ggttgtgaactgggagatggggccatggagaaaaaacccgagcctttgcaagttgattct
actgaaatgaaggatgttgtagatgatcgtttgcagactcacgagaatgatggcccaaga
gagatcgttgaggtgtctataaaagctcttgatttcattcctaacttgtttgatggcatt
gaaggagtggaaatagcagattctcgcaatccgaaagatatagttcctccactgtttaca
accgaagacaaggggaaagctcagagtagtgatattattcctccaattgtttcaacagaa
gacaaggggaaagctaagagctgtgatattattcctccacttgttataacagaagacatg
gggaaagctcagagcagtgatattattcatgatgtcgcagaacatatgaactctctttcg
tcgattgaggactgcctggcactgcttttgattgaacaaccggtagaatggacttgcgag
aactgttccaatgttgctgagctgcggagaacgaacagtagtaaaaatggtgaacagatg
atgggaagtactaatgtaaatacaacagttggtggagaccagactgaacaggatcagggc
agagggaagcaggtaaagctggatgatcatagtgtaaaacaagtggacaaagaccaaaat
gagcagaaaaatgaggatggtggtgccactcaaacaattttgcttaccaagctgccacct
gtattaaccattcaactgaagagatctgcggctgatctttctaaattggttggacatgtg
agctttaatgagattcttcatgtaggaccattcatggacccaagttgtgaggacaaagat
aactctagctatcgtctagttggtgtcattgagcacattggctccaccttgcgtggaggg
cattacattgcttatgtgagggcggatcgcaatcagcagagtgggtcttcctcatgggtt
tgtgcgaatgattcctccatcagagaagtctctctacaagaagttctcaggtgcgaggcc
tacattcttttctatgagaggatggaggaggaggacgactga

DBGET integrated database retrieval system