KEGG   Brachypodium distachyon: 100833051Help
Entry
100833051         CDS       T01717                                 

Definition
histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4-like
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
bdi  Brachypodium distachyon
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100833051
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100833051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 669 aa AA seqDB search
MEATDSVAVMEVAPVPDPLFTGATPATPPPEAAELVLRRSARCLNRPRPATYAEREEPKE
STARRARPKKKRDEENHDPVAQVPVKPARKSAKVEATERKPVPVTEPISCPDFAGAAEED
DATGNGKSAKLRVKETLRAFNSHYLHLVQEEQNRAQAVIQEIAKRPSKRPDLKAITKMQE
SNSVLYPEKRIGHLPGIDVGDQFYSRAEMVVLGIHSHWLNGIDYMGMKYREKKEYENLTF
PLATCIVMSGIYEDDLDKADEIIYTGQGGNDLLGNHRQIGSQLLQRGNLALKNSKDNGNP
VRVIRGHTAKNSYTGKVYTYDGLYKVVDDWVQNGVQGHVVFKYKLKRIEGQPSLTTSEVR
FTRAEAPRTISELPGLVCDDISGGQENIPIPATNLVDDPPVAPPDFVYIKSLKISKGIKI
PSSCAGCNCEGDCASNSNCACAQRNGSDLPYVSFKNVGRLVEPKAIVFECGANCSCNRNC
VNRTSQQGLQHRLEVFKTASKGWGVRTWDTILPGAPICEYVGVLRRTEEVSGLLQNNYIF
DIDCLQTMKGLDGREKRAGSEMHLPSLHTENDSEAPPAPEYCIDAGSIGNFARFINHSCN
PNLFVQCVLSSHNEVKLAKVMLFAADTILPLQELSYDYGYVLDSVVGEDGNTIQLPCCCG
APDCRKRLY
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgacggattcggttgctgtgatggaggtggcgccggtgccggacccgctattc
accggcgccactcccgcaacgccgcccccggaggcggcggagcttgtgctgcggcgcagc
gctcggtgcctcaacaggccacgccccgccacctacgcggagcgagaggagcccaaggag
tccaccgcccgccgggcccgccctaagaagaagagggacgaggagaaccacgacccggtg
gcgcaggttcctgtgaagccggctaggaagagtgccaaggtcgaggccacggaaaggaag
ccggtgcctgtcacggaaccgatttcttgtcctgatttcgccggagctgctgaggaggac
gatgcgacaggcaatggaaagagtgccaagctgcgggtgaaagaaaccttgcgggcattc
aacagccactatctccaccttgtccaggaagagcagaacagagcacaggcggtgatacag
gagattgcgaaacgcccttcgaagcggcctgacttgaaagcaattacaaagatgcaagaa
agcaattccgtgctttatccggagaaaaggataggacatctaccagggattgacgttggg
gatcaattttattctcgtgcggagatggtcgtgttgggcattcatagccattggctgaat
ggaattgactacatgggaatgaaataccgagaaaagaaggagtatgagaacttaactttc
ccattggcaacttgcattgtcatgtcggggatatatgaagatgatctggataaggctgat
gaaattatttataccggccaaggaggaaatgatttacttggtaaccatcgccaaattggt
tctcaactattgcaacgtgggaatttggcattgaagaatagcaaggataatggtaatccc
gtacgagttattcgaggtcatacagcaaagaatagctacacaggcaaagtctacacctat
gatggcctgtacaaggttgtagatgactgggtgcagaatggagtgcagggacatgtcgtt
ttcaaatataaattgaagagaattgagggacaaccgtcattgacaacctctgaggtgcgg
tttactcgtgcagaagcccccagaacaatttctgaattacctgggttggtttgtgatgac
atctcgggcgggcaggagaacattccgattcctgctactaatttggttgacgatccacct
gttgctccacctgatttcgtgtacatcaaatctctaaaaatttcgaagggcatcaagatt
ccttcaagttgtgctggctgcaattgtgaaggagattgcgctagcaactcaaattgtgca
tgtgctcaacgcaatggttctgatctaccttatgtatcattcaaaaatgttggcaggttg
gtggagcccaaagcaattgtatttgaatgcggggctaactgcagctgtaaccgcaattgc
gtaaacaggacatctcagcaaggtttgcagcatcgccttgaggtgtttaagacggcttca
aaaggatggggtgttcggacttgggacacaatccttcccggagcccctatctgcgagtac
gttggtgtgttgaggaggactgaagaagtatctggcttgctgcagaacaactacatattt
gacatcgattgtcttcagactatgaagggtctggatggacgagagaaaagagctgggtcc
gagatgcatctgccatctcttcacactgagaatgactccgaggcaccgcctgcaccggag
tactgcatagatgctggctccattggaaattttgcaaggttcataaaccacagttgtaac
cccaacctgtttgtccagtgcgtcttgagctcacacaatgaggttaagttggccaaagtg
atgctatttgccgcggacacgatactccctcttcaggagctttcgtatgattatgggtat
gtattggatagtgtggttggagaggatggcaacactatccaattaccttgctgctgtggt
gctcccgattgccggaaacgtctttactag

  All links  
No link information was found.   
DBGET integrated database retrieval system