KEGG   Brachypodium distachyon: 100833268Help
Entry
100833268         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 795 aa AA seqDB search
MDLLRSRLHKVRIPEPTNRIHKDECCVSFDTPRSEGGLYVDMNSFLGFGKEHVAWNFEKT
ENPVYLHIVQRRKPEPDEADRPLKKPTLLAIGVEGGFTDQEPEYDVTYEIVILPEFISLP
FPSVDLPEKVRLAVDKVILAESADRKQQLASWVADKKNVSAFAMDLQQLGNGVIVPPTGW
KCSKCDKTENLWLNLTDGMILCGRRLWDGSGGNNHAVEHYQQTKYPLAVKLGTITADLEA
ADVYSYPEDDSVEDPLLAQHLSHFGIDFSSLQKTEMTTAERELDHNTNFDWNRIQESGKD
AELLFGPGYTGLANLGNSCYMASIMQVMFSTHPFISRYFEKQSLKAAFAISQADPTLDLN
MQMTKLAHGMLSGKYSVRNQEGQEGIRPRMFKSVIAANHPEFSSMRQQDALDFFLHLIDK
VDQANPGNHELNPFTGFKFVIEERVQCPSGKVSYNKRSDYILSLSIPLHEASNKEQLEVF
NEKKAAMDLDGKEVSNEEVVRPRVPLEACLASFSGEDEIPDFYSTALNSKTTAIKTAGFK
TFPDYLVLQMRKFVMEAGWVPKKLDVYIDVPDIIDISHMRSKGVQPGEELLPEGASCGSK
AEPAQPVANEDIVSQLASMGFNYFHCQKAAINTSNTGVEEAMNWLLSHMDDPDIDDPLSQ
DQKPSEDAIDESSVQTLVSFGFQEDVARMALKASGGNIERATDWVFSHPEASSSVSAESS
TSNVKDDDSHIPDGSGRYKLVAFVSHMGTSTHCGHYVAHVLKDGRWAIFNDSKVAASVDL
PKDMGYLYFFQRISS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctccgctcgcgcctccacaaggtccgcatcccggagcccaccaaccgcatc
cacaaggacgagtgctgcgtctccttcgacacccctaggtcggagggggggctgtacgtg
gacatgaactcgttcctggggttcgggaaggagcacgtggcctggaacttcgagaagacg
gagaaccccgtgtacctccacatcgtgcagcgccgcaagccggaacctgacgaggcggat
cgcccgctgaagaagcccaccctactcgccatcggagtggagggaggttttactgatcaa
gaacctgaatatgatgttacttatgaaattgtaatcttacctgaattcatctctctcccg
tttccatcagttgacttgcccgagaaggtcaggcttgcagttgataaagttatacttgct
gaaagtgctgataggaagcaacaactggcttcttgggttgctgacaagaagaatgtcagt
gcatttgctatggatttgcagcaactaggcaatggcgttattgtgcctcctactggatgg
aaatgtagcaagtgcgataaaactgagaacctctggttaaatttaactgatggtatgatc
ctctgtgggaggcggctttgggatggaagtggtgggaataatcatgctgttgaacactac
cagcagactaaatatcctcttgctgtaaagcttggaacaattactgctgatttggaagca
gcagacgtttactcatacccggaagatgatagtgttgaagatccactattagctcagcac
ttgtcacattttggcatcgatttttcttcactccaaaagacagagatgactactgctgaa
agagaacttgaccacaacacaaattttgattggaatagaatacaagaaagtgggaaagat
gccgaacttttatttggaccaggttatactggtcttgcaaatcttggaaatagttgctac
atggcttcaattatgcaagttatgttttcaacccatccttttatatcacgatactttgag
aagcagagcttgaaagctgcatttgcaatttcccaagcagatccaacgttggacttaaac
atgcaaatgacaaagttggcacacggtatgctctctggcaaatattctgttcgcaatcag
gagggacaagaaggaatacgtccccgtatgttcaagtcagttattgcagcaaatcatcct
gaattttccagtatgagacaacaggatgcccttgacttcttccttcatcttattgataaa
gttgatcaggcaaaccctggaaaccacgagttaaatccttttacgggttttaagtttgta
attgaggagcgggttcaatgcccttctgggaaagtttcttacaacaaacgttctgactac
attctctcgctgagcataccactgcatgaagcaagtaacaaagagcagctagaagtgttt
aatgagaagaaagcagccatggacttggatggaaaggaagtatctaatgaggaagtcgtg
agaccaagagtcccactggaggcatgcttagcaagtttttcaggcgaagacgaaattcct
gatttttacagcactgcattaaattcaaagacgacagcaattaagactgctggctttaaa
acatttcctgattacctggtgctgcagatgcgcaagtttgtaatggaagcaggatgggtg
ccgaaaaagcttgatgtttatattgatgtgccggatattatcgatatctcgcacatgcgc
agcaaaggtgtacagcctggggaagagctactacctgaaggagcttcttgtggcagcaaa
gctgaacccgctcaacctgttgccaatgaggacattgtatcccagcttgcaagcatgggg
ttcaattacttccactgtcagaaagctgctattaatacatcgaatacaggagtcgaggag
gcgatgaattggcttctctctcacatggatgatccagatattgatgatccattatctcaa
gatcaaaagccttctgaagacgctattgatgaatcaagtgttcaaactcttgtttcgttt
ggattccaagaagatgttgctcgaatggccttgaaagcttcaggtgggaatattgagaga
gccacggactgggttttcagtcaccctgaagcatctagctccgtatctgctgagtcttca
acaagcaatgtaaaagatgatgactcacacataccagatggaagtggcagatacaagctg
gtggcatttgtgagccatatgggcacctctacccactgtgggcactatgtcgcccatgtc
ctgaaagacgggaggtgggcaatcttcaacgacagtaaagttgctgcatcagttgacctg
cccaaagatatgggatacctttatttcttccagaggataagcagttaa

DBGET integrated database retrieval system