KEGG   Brachypodium distachyon: 100833268Help
Entry
100833268         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100833268
Peptidases [BR:bdi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100833268
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100833268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 795 aa AA seqDB search
MDLLRSRLHKVRIPEPTNRIHKDECCVSFDTPRSEGGLYVDMNSFLGFGKEHVAWNFEKT
ENPVYLHIVQRRKPEPDEADRPLKKPTLLAIGVEGGFTDQEPEYDVTYEIVILPEFISLP
FPSVDLPEKVRLAVDKVILAESADRKQQLASWVADKKNVSAFAMDLQQLGNGVIVPPTGW
KCSKCDKTENLWLNLTDGMILCGRRLWDGSGGNNHAVEHYQQTKYPLAVKLGTITADLEA
ADVYSYPEDDSVEDPLLAQHLSHFGIDFSSLQKTEMTTAERELDHNTNFDWNRIQESGKD
AELLFGPGYTGLANLGNSCYMASIMQVMFSTHPFISRYFEKQSLKAAFAISQADPTLDLN
MQMTKLAHGMLSGKYSVRNQEGQEGIRPRMFKSVIAANHPEFSSMRQQDALDFFLHLIDK
VDQANPGNHELNPFTGFKFVIEERVQCPSGKVSYNKRSDYILSLSIPLHEASNKEQLEVF
NEKKAAMDLDGKEVSNEEVVRPRVPLEACLASFSGEDEIPDFYSTALNSKTTAIKTAGFK
TFPDYLVLQMRKFVMEAGWVPKKLDVYIDVPDIIDISHMRSKGVQPGEELLPEGASCGSK
AEPAQPVANEDIVSQLASMGFNYFHCQKAAINTSNTGVEEAMNWLLSHMDDPDIDDPLSQ
DQKPSEDAIDESSVQTLVSFGFQEDVARMALKASGGNIERATDWVFSHPEASSSVSAESS
TSNVKDDDSHIPDGSGRYKLVAFVSHMGTSTHCGHYVAHVLKDGRWAIFNDSKVAASVDL
PKDMGYLYFFQRISS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctccgctcgcgcctccacaaggtccgcatcccggagcccaccaaccgcatc
cacaaggacgagtgctgcgtctccttcgacacccctaggtcggagggggggctgtacgtg
gacatgaactcgttcctggggttcgggaaggagcacgtggcctggaacttcgagaagacg
gagaaccccgtgtacctccacatcgtgcagcgccgcaagccggaacctgacgaggcggat
cgcccgctgaagaagcccaccctactcgccatcggagtggagggaggttttactgatcaa
gaacctgaatatgatgttacttatgaaattgtaatcttacctgaattcatctctctcccg
tttccatcagttgacttgcccgagaaggtcaggcttgcagttgataaagttatacttgct
gaaagtgctgataggaagcaacaactggcttcttgggttgctgacaagaagaatgtcagt
gcatttgctatggatttgcagcaactaggcaatggcgttattgtgcctcctactggatgg
aaatgtagcaagtgcgataaaactgagaacctctggttaaatttaactgatggtatgatc
ctctgtgggaggcggctttgggatggaagtggtgggaataatcatgctgttgaacactac
cagcagactaaatatcctcttgctgtaaagcttggaacaattactgctgatttggaagca
gcagacgtttactcatacccggaagatgatagtgttgaagatccactattagctcagcac
ttgtcacattttggcatcgatttttcttcactccaaaagacagagatgactactgctgaa
agagaacttgaccacaacacaaattttgattggaatagaatacaagaaagtgggaaagat
gccgaacttttatttggaccaggttatactggtcttgcaaatcttggaaatagttgctac
atggcttcaattatgcaagttatgttttcaacccatccttttatatcacgatactttgag
aagcagagcttgaaagctgcatttgcaatttcccaagcagatccaacgttggacttaaac
atgcaaatgacaaagttggcacacggtatgctctctggcaaatattctgttcgcaatcag
gagggacaagaaggaatacgtccccgtatgttcaagtcagttattgcagcaaatcatcct
gaattttccagtatgagacaacaggatgcccttgacttcttccttcatcttattgataaa
gttgatcaggcaaaccctggaaaccacgagttaaatccttttacgggttttaagtttgta
attgaggagcgggttcaatgcccttctgggaaagtttcttacaacaaacgttctgactac
attctctcgctgagcataccactgcatgaagcaagtaacaaagagcagctagaagtgttt
aatgagaagaaagcagccatggacttggatggaaaggaagtatctaatgaggaagtcgtg
agaccaagagtcccactggaggcatgcttagcaagtttttcaggcgaagacgaaattcct
gatttttacagcactgcattaaattcaaagacgacagcaattaagactgctggctttaaa
acatttcctgattacctggtgctgcagatgcgcaagtttgtaatggaagcaggatgggtg
ccgaaaaagcttgatgtttatattgatgtgccggatattatcgatatctcgcacatgcgc
agcaaaggtgtacagcctggggaagagctactacctgaaggagcttcttgtggcagcaaa
gctgaacccgctcaacctgttgccaatgaggacattgtatcccagcttgcaagcatgggg
ttcaattacttccactgtcagaaagctgctattaatacatcgaatacaggagtcgaggag
gcgatgaattggcttctctctcacatggatgatccagatattgatgatccattatctcaa
gatcaaaagccttctgaagacgctattgatgaatcaagtgttcaaactcttgtttcgttt
ggattccaagaagatgttgctcgaatggccttgaaagcttcaggtgggaatattgagaga
gccacggactgggttttcagtcaccctgaagcatctagctccgtatctgctgagtcttca
acaagcaatgtaaaagatgatgactcacacataccagatggaagtggcagatacaagctg
gtggcatttgtgagccatatgggcacctctacccactgtgggcactatgtcgcccatgtc
ctgaaagacgggaggtgggcaatcttcaacgacagtaaagttgctgcatcagttgacctg
cccaaagatatgggatacctttatttcttccagaggataagcagttaa

DBGET integrated database retrieval system