KEGG   Brachypodium distachyon: 100833755Help
Entry
100833755         CDS       T01717                                 

Definition
(RefSeq) protein disulfide isomerase-like 5-2
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100833755
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100833755
Chaperones and folding catalysts [BR:bdi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100833755
Membrane trafficking [BR:bdi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100833755
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100833755
  Exosomal proteins of colorectal cancer cells
   100833755
  Exosomal proteins of bladder cancer cells
   100833755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Calsequestrin Thioredoxin_8 Thioredoxin_7 Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 100833755
NCBI-ProteinID: XP_003579772
UniProt: I1IXU8
Position
5
AA seq 421 aa AA seqDB search
MATTLPPLPLLCLLPLLLVAFATAGGGSGGGGGENFPRDGRVIDLDDSNFEAALSSIDFL
FVDFYAPWCGHCKRLAPELDEAAPVLAGLSEPIMVAKVNADKYRKLGSKYGVDGFPTLML
FIHGVPIEYTGSRKADLLVRNLKKFVAPDVSILESDSAIKSFVENAGTSFPMFIGFGVNE
SLITEYGGKYKKRAWFAIAQDFSEELMMAYGFDKAPALVALHPKYNEQSVFYGPFEGRFL
EDFIRQSLLPLTVPINTETLKLLDDDDRKVVLAILEDDSDENSAQLVTVLRSAANANRDL
VFGYVGVKQWEEFVETFDVSKSSQLPKLLVWDRNEEYEQVDGSERLEEGDQASQISQFLE
GYRAGRTTKKKVSGPSFMGFMHSLVSMNSLYILMFVVALLGVMLYFSGQDDTPQLRRIHD
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgactctgccgccgctccctctcctctgcctcctcccgctgctgctagtcgcc
tttgccactgccggcggcggcagcggcggcggcggcggcgagaacttcccgcgggatggg
agggtgatagacctggacgacagcaacttcgaggcggctctgagctccatcgacttcctc
ttcgtcgacttctacgcaccatggtgcggccactgcaagcgcctcgcccccgagttagat
gaagctgcacctgtgttggcgggactgagcgagccaatcatggttgccaaagtaaatgcc
gacaaatacaggaaacttggatcgaaatacggagtggatgggttcccaactctgatgctg
tttatccatggggtccctatcgaatacactggttcaaggaaagctgatttgcttgtgcgg
aatcttaagaagtttgttgcacctgatgtttctattcttgagtctgattctgcaatcaag
agctttgttgagaatgctggcacaagctttccgatgttcatcggttttggggtcaatgag
tcgttgatcactgaatatggaggaaaatacaagaaaagagcatggtttgctattgcacaa
gatttttcggaggagctcatgatggcatatggttttgataaggccccagcactggttgcg
ttgcatccgaagtataacgaacaaagtgtattctatggcccatttgaaggacgtttcttg
gaagattttatacggcaatcgctgctacctttgactgtccccatcaacacagagacactt
aaattgttggatgatgatgacagaaaagttgttctcgcaattttggaggatgactcagat
gaaaattctgcacagttggtaacagttttgaggtctgctgctaatgcaaaccgtgacttg
gtgtttggatatgttggagttaaacaatgggaggagtttgtggagacttttgatgtttcc
aagagctcacagttgccaaagctactagtgtgggatagaaatgaggagtatgaacaagtg
gacggttcagaaaggttagaagaaggtgaccaagcatctcaaataagccaattcctcgag
ggatatagagcaggaagaacaacaaaaaagaaagtcagcggcccttccttcatgggtttc
atgcactctcttgtcagcatgaactcattatacattcttatgtttgttgttgctcttctt
ggtgtcatgctatacttttctggccaagatgatactcctcagctaagacgaattcatgac
gagtga

DBGET integrated database retrieval system