KEGG   Brachypodium distachyon: 100834215Help
Entry
100834215         CDS       T01717                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bdi  Brachypodium distachyon
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bdi01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:bdi00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 381 aa AA seqDB search
MSQLSHQVSLTLGSTRPDSLFLPLLPSPAGPNSPFLRRFAKRSPHSARGDGGDWSGEQER
ERRSLRPSARPSSPMAVLVLVLVLAACAALAPVASAVPFIVLHGIGDQCGNDGIASFTDE
LGKWSGSKGYCMEIGRGSWDSWIMPLQEQANAVCNKVKEMKDLHEGYNIIGLSQGNLIGR
AVIEYCDDGPPVKNFISIGGPHAGTASVPLCGSGILCILVDALIQLEIYSNYVQAHLAPS
GYLKIPTDMAEYLKGCKFLPKLNNEIPSERNATYKERFSSLENLVLIMFQDDAVLIPRET
AWFGYYPDGSFNPVLPPQKTKLYTEDWIGLRTLDETGRVKFVSVPGGHLRISRSDMKKYI
VPYLKPSCGSLKQSARRILLD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaactgtcacaccaagtgtctctgacactggggtccacccgaccagactctctc
ttcctccctcttctccccagtcccgccggccccaattcaccatttcttcgccgcttcgcc
aagagaagcccccactccgcgcgaggcgacgggggagactggtctggagagcaggaacga
gagaggcgaagccttagacctagcgctcgaccctcctcaccgatggccgtcctcgtccta
gtccttgtcctcgccgcctgcgcagcgctcgcgccggtggcttccgccgtgcccttcatc
gtcctgcacgggattggggaccagtgcgggaacgacggaatcgcctcgttcactgatgag
ctcgggaagtggtcggggtccaagggctactgcatggaaattgggagaggatcatgggac
tcttggataatgccactgcaagagcaggcaaatgcagtttgcaacaaggtaaaggaaatg
aaagatctccatgaaggttacaacataattggcctttctcaggggaacttaattggccgt
gcagtgattgagtactgcgatgatggaccaccggtaaagaatttcatctcaattgggggt
cctcacgctggtactgcttcagtgcctctttgcggttccggcatcctttgtattcttgtt
gatgctctgattcaattggagatatattcaaactatgtgcaggcacaccttgctcctagt
ggttacctaaagattcccactgatatggcagaatatttgaagggatgcaaatttcttcca
aagcttaataatgagataccaagtgaaagaaacgctacatacaaagaaagattcagcagc
ttggagaacttggtgttaatcatgttccaggacgatgcagtcttaatacctcgggaaact
gcatggtttggttattaccctgatggctcttttaatccagtgctacctcctcagaagaca
aaactatatactgaagactggatcggcttgaggactctggacgagaccgggcgcgtcaag
tttgtgtcagttccaggaggtcacctccgcatctccaggagcgacatgaagaagtacatc
gtgccttacttgaagccgtcgtgtggatcattgaagcagagtgctcgtcggatcttgttg
gattga

DBGET integrated database retrieval system