KEGG   Brachypodium distachyon: 100834215Help
Entry
100834215         CDS       T01717                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bdi  Brachypodium distachyon
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100834215
  Lipid metabolism
   00062 Fatty acid elongation
    100834215
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100834215
Lipid biosynthesis proteins [BR:bdi01004]
 Fatty acid synthase
  Component type
   100834215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 381 aa AA seqDB search
MSQLSHQVSLTLGSTRPDSLFLPLLPSPAGPNSPFLRRFAKRSPHSARGDGGDWSGEQER
ERRSLRPSARPSSPMAVLVLVLVLAACAALAPVASAVPFIVLHGIGDQCGNDGIASFTDE
LGKWSGSKGYCMEIGRGSWDSWIMPLQEQANAVCNKVKEMKDLHEGYNIIGLSQGNLIGR
AVIEYCDDGPPVKNFISIGGPHAGTASVPLCGSGILCILVDALIQLEIYSNYVQAHLAPS
GYLKIPTDMAEYLKGCKFLPKLNNEIPSERNATYKERFSSLENLVLIMFQDDAVLIPRET
AWFGYYPDGSFNPVLPPQKTKLYTEDWIGLRTLDETGRVKFVSVPGGHLRISRSDMKKYI
VPYLKPSCGSLKQSARRILLD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaactgtcacaccaagtgtctctgacactggggtccacccgaccagactctctc
ttcctccctcttctccccagtcccgccggccccaattcaccatttcttcgccgcttcgcc
aagagaagcccccactccgcgcgaggcgacgggggagactggtctggagagcaggaacga
gagaggcgaagccttagacctagcgctcgaccctcctcaccgatggccgtcctcgtccta
gtccttgtcctcgccgcctgcgcagcgctcgcgccggtggcttccgccgtgcccttcatc
gtcctgcacgggattggggaccagtgcgggaacgacggaatcgcctcgttcactgatgag
ctcgggaagtggtcggggtccaagggctactgcatggaaattgggagaggatcatgggac
tcttggataatgccactgcaagagcaggcaaatgcagtttgcaacaaggtaaaggaaatg
aaagatctccatgaaggttacaacataattggcctttctcaggggaacttaattggccgt
gcagtgattgagtactgcgatgatggaccaccggtaaagaatttcatctcaattgggggt
cctcacgctggtactgcttcagtgcctctttgcggttccggcatcctttgtattcttgtt
gatgctctgattcaattggagatatattcaaactatgtgcaggcacaccttgctcctagt
ggttacctaaagattcccactgatatggcagaatatttgaagggatgcaaatttcttcca
aagcttaataatgagataccaagtgaaagaaacgctacatacaaagaaagattcagcagc
ttggagaacttggtgttaatcatgttccaggacgatgcagtcttaatacctcgggaaact
gcatggtttggttattaccctgatggctcttttaatccagtgctacctcctcagaagaca
aaactatatactgaagactggatcggcttgaggactctggacgagaccgggcgcgtcaag
tttgtgtcagttccaggaggtcacctccgcatctccaggagcgacatgaagaagtacatc
gtgccttacttgaagccgtcgtgtggatcattgaagcagagtgctcgtcggatcttgttg
gattga

DBGET integrated database retrieval system