KEGG   Brachypodium distachyon: 100834330Help
Entry
100834330         CDS       T01717                                 

Definition
eukaryotic translation initiation factor 3 subunit J-A-like
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
bdi  Brachypodium distachyon
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:bdi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 231 aa AA seqDB search
MEDWDAEDFQPVAPIAEPKLKSNWDDEDVEEDDVKESWEEEEEEKPKPQPVEKPAPKPSA
KSAAKKGKQPSTSTEVVEDEVLDDPAKEKLRQQRLVEEADFKSTAELFAKKDGSEKSLDT
FIPKSESDFAEYAELIANKLRPYEKSFHYMGLLKNVMRLSMTSLKGADAKEIASSVTAIA
NEKIKAEKEAAAGKKKQGAKKKQLHIEKGEEDFVARPGAGSYDDPDEFDFM
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaggactgggatgctgaagattttcaaccagttgcacctattgcggaacccaagctt
aaaagtaactgggatgatgaagatgtggaagaagatgatgtaaaagaatcatgggaagag
gaggaggaagagaaacctaagccacagcctgtagaaaagcctgctccaaaacctagtgct
aaaagtgctgcaaaaaaaggcaaacagccatcgacaagtactgaagtagtagaagatgag
gttcttgatgatcctgctaaagaaaagcttcgccaacaaaggctagtggaagaagctgat
ttcaagtcaacagcagagcttttcgcaaagaaggatggcagtgaaaagtcattagatact
tttatccccaaatctgagagtgactttgcggaatatgcagagcttattgcaaacaaacta
cgtccctatgagaaaagttttcactatatgggtctacttaagaatgtcatgagactttcc
atgacatcgttgaaaggtgcggatgcgaaggaaatagcttcgtccgtcacagcaattgct
aatgaaaagatcaaggctgaaaaggaagctgcagcaggcaaaaagaaacaaggagccaaa
aagaagcagctccatatagagaaaggagaggaggactttgttgcccggcctggtgcgggt
tcttatgacgacccggacgagttcgacttcatgtga

DBGET integrated database retrieval system