KEGG   Brachypodium distachyon: 100834585Help
Entry
100834585         CDS       T01717                                 

Definition
choline/ethanolamine kinase-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
bdi  Brachypodium distachyon
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bdi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 354 aa AA seqDB search
MAAVDPAPNGAALKRSTSIDRIPEEARRILHRLAGELWGGDVDPAALVVSQLKGALTNEV
FRITWPGGEGDPRKVLVRIYGQGVEVFFDRADEVRTFECMSRHGQGPRLLGRFPQGRVEE
FINARTLSAEDLRDEQISSLIAKKLREFHELDMPGPKNVSLWQRLRRWLEEARGRCSAEE
AKEFRLETLGNEITELEDALSGFDQRVVFCHNDLQYGNIMIYEETRQVTLIDYEYASFNP
VAFDIANHFCEMSADYHTATPHVLDFTKYPDMDEQRRFVQTYLSYPGEKSPEVEVENLLE
LIGKYTLASHLFWGLWGAVSEHVNKNIDFEYDEYARQRFDRYWQTKAGILRRAN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtggacccggcgcctaacggggccgccctgaagcggagcaccagcatcgac
cgcatccccgaggaggcgcgccggatcctgcaccgcctcgccggggagctctggggcggc
gacgtcgaccccgccgcgctcgtcgtgtcgcagctcaagggcgccctcaccaacgaggtc
ttccggatcacctggcccggcggcgagggcgacccgcgcaaggtgctcgtccgcatctac
ggccagggcgtcgaggtcttcttcgaccgcgccgacgaggtccgcaccttcgagtgcatg
tcccgccacggccagggcccccgcctcctcggccgcttcccccagggccgcgtcgaggag
ttcatcaacgctaggacgctctcggcggaggatctgcgcgacgagcagatatcctcgctg
attgccaagaagctgcgggagtttcacgagcttgacatgcctggacccaagaacgtgtca
ttgtggcagaggctgagacggtggcttgaggaagctcgtggcaggtgctcggcagaggag
gctaaggaattccggttggagacgcttggcaatgagattacagagctggaggatgcattg
tcagggtttgatcagagagtagtgttttgccataatgatttacagtatggaaacattatg
atatatgaagagactagacaagtgaccttaattgactacgagtacgccagttttaaccct
gtagcatttgacattgctaatcacttttgtgagatgtctgctgattatcatacagctaca
ccacatgttctggacttcacaaaataccctgatatggatgaacagcggcgatttgttcag
acttaccttagctatccaggtgaaaaatcaccagaagtggaagttgaaaatttacttgaa
ttgattgggaaatatactcttgcaagccatctcttttggggtctctggggagcagtctcg
gagcacgtgaacaagaacattgacttcgagtacgatgagtacgcaaggcagcgatttgac
cggtactggcagacaaaggccggaatactccgacgagcaaattag

DBGET integrated database retrieval system