KEGG   Brachypodium distachyon: 100834631Help
Entry
100834631         CDS       T01717                                 

Definition
histone deacetylase 6-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100834631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 457 aa AA seqDB search
MAASGEGASLPSPAGGEDGRRRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHSLVVHYGL
HRLLELSRPFPASEADISRFHSEEYVSFLASATGNPNILDPRAVKRFNVGEDCPVFDGLF
PFCQASAGGSIGAAVKLNRGDADITVNWAGGLHHAKKGEASGFCYVNDIVLAILELLKFH
RRVLYVDIDVHHGDGVEEAFFTTNRVMTVSFHKYGDFFPGTGHITDVGAGEGKHYAVNVP
LSDGIDDSTFRDLFQCIMKRVMEVYQPEVVVLQCGADSLAGDRLGCFNLSVKGHADCLRY
LRSFNVPMMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNDYYEYFGPDYNLHIEP
RSVENLNTTKDLENIKNMILDHLSTLEHVPNTQFHDRPSDPEAPAEKEEDMDKRPSQRSR
LWSGGAYDSDTEDPDMKTEANDLIANSIVKDESNDDL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcaggcgaaggagcgtcgctgccgtctccggcgggtggcgaggacggccgc
cgccgtcgtgtcagctatttctacgagcccacgatcggcgattactactacgggcagggc
cacccgatgaagccgcaccgcatccgcatggcgcactcgctggtcgtccactatggtctc
caccgcctactcgagctctcccgccccttccctgcctccgaagccgacatcagccgcttc
cactccgaggaatacgtctccttccttgcctccgccactgggaacccgaacatcctcgac
ccccgcgccgtcaagcgcttcaacgtcggtgaggattgccccgtctttgacggtctcttc
cccttctgccaggcgtccgctggcggcagcatcggcgccgccgtcaagctcaaccgtggg
gacgccgacatcaccgtgaactgggctggcgggctccaccacgccaagaagggcgaggcc
tccggattctgctacgtcaacgacatcgtcctcgccatcctcgagcttctgaagttccac
aggcgtgtgctatatgtagacattgatgtccaccatggagatggtgtggaggaggccttc
ttcactacaaaccgagtcatgacggtttctttccacaagtatggggacttcttccctggt
actggacacattactgatgttggagctggtgaaggaaaacattatgctgtaaatgtcccc
cttagtgatggcattgatgactctacctttcgtgatctgttccaatgcatcatgaagaga
gtaatggaggtttatcagccagaggttgttgttctccaatgtggggctgactctttggcc
ggagataggttaggctgctttaatctgtctgtgaaaggccacgcagactgcctccgttac
cttaggtcattcaatgttcctatgatggttttagggggtggaggttacaccatcagaaat
gttgctcgctgctggtgctatgagactgcagttgccgttggggttgaacctgataacaag
ttgccttataatgattactatgagtactttggccctgactataatcttcatattgaacca
agaagcgtagagaatttaaatactacaaaagacctggagaatataaagaacatgatactg
gatcatctttcaacattagaacatgtcccaaacactcaatttcatgatagaccatctgat
cctgaagctccagcagagaaggaggaggatatggacaagagaccaagtcagcgcagcaga
ttatggagcgggggagcttatgattctgacacagaagatcctgacatgaaaactgaggct
aacgacttaattgccaattctatcgtgaaggatgaatcaaatgatgatttgtag

DBGET integrated database retrieval system