KEGG   Brachypodium distachyon: 100834738Help
Entry
100834738         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 17-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 959 aa AA seqDB search
MASLASLVAGVVALAVVTLATVVRHRGRRAAARREEDVRWLASIAAREFEIAEWQAYYYS
AHHGASGRADDVAEAPWYWTAPEVASPWIEQEQQAVAEPMIPAAAEPMTPAAAEPMTPEA
AGKAWGLCARCRRMTTRRCARCKIVKYCSMKCQVSHWRRVHKFECHVPSIDAKKDSTSAT
EGVECNSSYEQSVVAGVEPAVKISNSVATMPELSKENCDAKLLGNESKEMPFQEASNTAE
SPQVTGLTESADVLSFPTSGKDCKVQGASVSENGSQSQIPADNSSSQAHCSAGFESELEQ
SSKQAPCIDNIKSSRSLPPMSTTDKVPSTCAGANFPVRNPSKKTDSLPAMSVGSENEVVV
PNNLSTDLIRQQTAPKILSHSPSESTLFPYELFTKLYNFDKVELRPFGLCNLGNSCYVNA
VLQCLAFTRPLTAYLFEGLHSKKCKLMLNFYSMCYTAFCSKKEWCFLCEFEKLIVEGKAG
KSPLSPTGILSHLHDIGSSFGLGKEEDAHEFLRYAIDTIQRASMKEAEKNGVGKLAEETT
LMQLMFGGFVRSQIKCTKCQVSSGQCERILDLTVEIDGDISTLEEALHQFTSTEVLDGDN
KYHCSRCNSYERAKKKLTIYEAPNILTIALKRYQTGSSGKINKAISFPECLNLSSYMSTT
NDYSPVYRLYAVVVHHDVQNAAFSGHYVCYVKDSHEKWHEMDDRQVKSVSLEKVLTKCAY
MLFYARCSPRTPRSLRKVIIAQNPSRTKKTGQTLDPEITLRSSYLSRHQGGQLCRDHVLH
NHTHILYTFSDSSHQVLVSPSPSRSSSLFSNSDSGSIGTFRSDSTDSTVSSNSMGQYDYI
FGSSDQMYPLSTAVIPGEHERGTSQRSSDQYADQAGKVERLNKLNNQASIGVWDEGGTSR
SFFYTDQGKHQGSRSTCSSSYSSSCSSSGKLIEHRSRRTVGERAAVHTNRRWVDQLVGI
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgctggcgtcgctcgtggccggggtggtggccctcgcggtcgtgacgctggcc
acggtggtgcgccacaggggccgccgcgcggccgcgcggagggaggaggacgtgcgctgg
ctagccagcatcgctgcgagggagttcgagatcgcggagtggcaggcgtactactatagt
gctcatcacggcgcgtccgggcgcgcggacgacgtcgcggaggcaccgtggtactggaca
gcgccggaggtggcttcgccgtggatcgaacaggagcagcaggcggtggcggaacctatg
ataccggcagcggcggaacccatgacaccggcagcggcggaacctatgacaccggaagcg
gcggggaaggcctggggattgtgcgcgaggtgccgcaggatgactacgcgccggtgcgct
aggtgcaagatcgtcaagtactgtagcatgaaatgtcaggtttcacactggagaagagtg
cacaaatttgagtgccatgtaccaagtattgatgctaagaaagacagtacaagtgcaacg
gaaggagttgaatgcaatagttcatatgaacaaagtgtggtggctggagtagaaccagcg
gttaaaatcagcaattcagttgctacaatgcctgaactttctaaggaaaactgcgatgca
aagctcttaggtaatgaaagtaaggagatgccctttcaggaggcatccaataccgcagag
tctcctcaggttacaggactgacagaatctgctgatgttcttagtttcccaacttctggt
aaagattgcaaagtccagggtgcttctgttagtgagaatggctcccagtctcagattcca
gcagacaactctagttctcaagctcattgctctgctgggttcgaatctgaactggagcaa
tctagcaaacaagctccttgcatagacaacattaaaagctcaagaagtttgccacccatg
tcaactactgacaaagttccttcgacgtgtgctggtgcaaactttccagtgcgtaaccca
tctaaaaagacagatagtcttcctgcaatgtctgttggatcagagaacgaagttgttgtg
ccaaataatttgtcaacggatttgatcaggcaacaaactgctccaaaaattttgagtcac
tctccatcagaatcgacactttttccgtatgaacttttcaccaagctctacaactttgac
aaagtggagttacgtccttttggcctatgcaaccttgggaatagttgctatgtaaatgca
gttcttcagtgcttagcatttacccgcccacttacagcataccttttcgaaggacttcat
tcaaaaaaatgtaaactgatgctgaacttttattccatgtgttacactgcattttgttcc
aaaaaggaatggtgcttcttgtgcgaatttgaaaaactcattgtggagggcaaggctgga
aaatctccattatcacctactggaatactctctcatttgcatgacattggaagtagcttt
ggcctgggcaaagaagaagatgcccatgagtttctcaggtatgcaattgacactatccaa
agagctagcatgaaggaagccgagaagaatggtgttggcaagttagctgaagaaactaca
ctgatgcaattaatgttcgggggctttgtacgatcacagataaaatgcacaaagtgtcag
gtcagttcgggacagtgtgaacgtattcttgatcttactgttgaaatagatggggatatc
agcacccttgaagaagcacttcatcagtttacatctacagaagttttagatggagataat
aaataccattgtagcagatgcaattcatatgagcgtgccaaaaagaagttgacaatatat
gaagcaccaaatatcctgactattgcattgaaaagatatcagacaggttcgtctggcaag
atcaataaggcgatcagtttcccggaatgcttgaatttgtctagttacatgagtacaaca
aatgactattcccctgtgtacaggctctatgctgtggttgtccatcatgatgttcagaat
gcagccttttctggtcattatgtatgttatgtcaaggattcacacgagaagtggcatgag
atggatgatcgccaggtgaaatctgtttccctggaaaaggtcctgacgaagtgtgcatat
atgttgttttatgcaaggtgctcaccacgcactccaagatctttaaggaaagtgataatt
gctcaaaacccatcacgcacgaagaaaaccgggcagacattagatccagaaataacattg
cgaagcagttacttgagcagacaccaaggtgggcagttgtgtagggatcatgtactgcat
aaccacacgcacatattgtatacatttagtgactcatcacatcaagtattggtctcccca
agtccaagcagaagttcttctctgttcagcaattctgattcagggtcaatcggtacgttc
agaagtgatagtactgatagcacagtgagctcaaacagcatggggcagtatgattacata
tttggaagttcggatcagatgtacccactaagcacagcggttatacctggggaacatgag
cgtgggacgagccagaggtcttcagatcaatatgctgatcaagcaggtaaggttgaaagg
ctgaacaagctcaacaatcaggcaagcataggggtttgggatgagggtgggacgagccga
tcattcttctatactgaccaaggtaaacatcagggtagtcgtagtacgtgtagcagcagt
tatagtagtagctgtagcagcagtggtaagttaatagaacaccgtagccgtaggacggta
ggggagagggcggcagttcatacaaacaggaggtgggtggatcaattggtcggtatctag

DBGET integrated database retrieval system