KEGG   Brachypodium distachyon: 100834779Help
Entry
100834779         CDS       T01717                                 

Gene name
MPK6
Definition
mitogen-activated protein kinase 1-like
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
bdi  Brachypodium distachyon
Pathway
Plant hormone signal transduction
Class
Environmental Information Processing; Signal transduction; Plant hormone signal transduction [PATH:bdi04075]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 391 aa AA seqDB search
MDGGAQPPDAEMADAGAAVPGAGAGAAGTMENIQATLSHGGRFIQYNIFGNVFEVTVKYK
PPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIV
AIRDIIPPAQRNSFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSA
NVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTA
AIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLP
RHARQSFSEKFPHVHPSAIDLVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCTMP
FSFDFEQHALSEEQMKDLIHQEALAFNPDYQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggacggcggtgctcagccgccggacgcggagatggcggacgccggggcggcggtgcct
ggggcgggtgcgggtgcggcggggacgatggagaacatccaggcgacgctcagccatggg
ggcaggttcatccagtacaacatcttcggcaacgtcttcgaggtcaccgtcaagtacaag
ccccccatcctccccatcggcaagggcgcctacggcatcgtctgctccgcgctcaactcg
gagaccggggagcaggtggccatcaagaagatcgccaacgccttcgacaacaagatcgac
gccaagcggacgctccgggagatcaagctgctccgccacatggaccacgagaatattgtt
gcaataagggatattatacctcctgcccagaggaattcgttcaatgacgtctatattgca
tatgaactgatggacaccgatctgcatcaaattattcgctcaaatcaagctttatcagag
gaacactgtcagtatttcctctaccaaattcttcgtggcttgaagtatatacattcggca
aatgttcttcaccgagacttgaagccgagcaatcttcttttgaatgcaaattgtgaccta
aagatatgcgattttgggcttgctcgtaccacctcagaaactgattttatgactgagtat
gttgtgacaagatggtacagggcaccagagcttttgttgaactcttccgaatacacggca
gcaattgatgtatggtctgtgggttgtatatttatggaactgatggataggaaacctttg
tttccaggaagagaccatgttcatcagctgcgtctactaatggagctcatcgggacgcca
aatgaggctgatttggattttgtaaatgaaaatgcaagaagatatatccgccaacttccc
cgtcatgcaaggcagtccttctctgaaaaatttccacatgtccacccttcagcaattgac
ttggttgagaagatgctgacttttgatcctagacagagaataacagttgaaggtgcactt
gcacatccttacttggcatcgctgcatgacattagtgatgagccagtgtgcacgatgccc
ttcagctttgactttgagcagcatgcattatcagaagaacaaatgaaggatctaatccac
caagaggccctagcattcaaccctgattaccagtag

DBGET integrated database retrieval system