KEGG   Brachypodium distachyon: 100834872Help
Entry
100834872         CDS       T01717                                 

Definition
probable polyprenol reductase 1-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100834872
    1.3.1.94  polyprenol reductase
     100834872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 355 aa AA seqDB search
METEGGPTLQPLLCLAWLAATLPIVAAALPIPAAAGGRLVHGLLSAFSARGKTVKPSSSA
ASSSSSSSKAKFTVPQKYFLHFYVVGVTVTTSLLLVICFYAYMKMTPLLPEPSSYSTIAS
HLVGSNSFSIGSVRSRTMEHKYRVWRTVFVLLLMEIQVLRRLYETEHVFHYSPSARMHIV
GYLTGLFYYTAAPISLASSCLPEATDYLQGQIAEFIVKGRARTPDLVIDYSSLLKPLLKL
GWCQWIGAVIFIWGSLHQIRCHAILGSLREHKDSDEYVIPCGDWFSRVSCPHYLAELVIY
LGVLIASGGSDISVWFLFIFVITNLSFAAVQTHRWYLQKFEDYPRSRYAIIPFVL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagacggagggcgggcccaccctccagcctttgctgtgcctcgcgtggctcgccgcc
acgctccccatcgtcgccgccgcgctgccgatccccgcggctgccggcggccgcctcgtg
cacggcctcctctccgccttctccgcccgcgggaagaccgtgaagccgtcttcctccgcc
gcgtcctcctcctcctcctcctctaaggcgaagttcactgttccacaaaagtactttttg
catttctatgtggtgggagtgacggtgacaacaagcttgctgcttgtaatatgcttctat
gcatatatgaaaatgacaccattgttgccagagccatcgagttactccacaattgctagc
catcttgttgggtcaaattcgttttctattggcagtgtcagatctcgcaccatggaacac
aagtatcgtgtctggcggactgtatttgtacttctattgatggaaattcaggtgctgaga
cgactatatgagactgaacatgtgttccactacagcccttcagctcggatgcacattgta
ggatacctgacgggtctattctattacacggctgcacctatatctcttgctagctcttgt
cttcctgaagcaacagattatcttcaaggtcaaatagctgagttcatagtgaaaggtcgt
gcaagaacaccagacctagtcattgattattcgtctctcctaaagcctcttttaaagttg
gggtggtgccaatggataggtgctgtgatattcatttggggatccctccatcagatccgt
tgccatgcaattcttggatccttgcgtgaacacaaagattctgatgaatatgttattcct
tgcggtgactggtttagtcgtgtgtcttgccctcactacctcgctgaactagtcatatat
ttgggcgtgctgatagctagtggtggatcagacatttcagtctggttcctgttcattttt
gtgataactaatctgtctttcgcagcagtacaaactcatagatggtaccttcaaaagttt
gaagactaccctcgttctcgctatgctatcattccatttgtattgtag

DBGET integrated database retrieval system