KEGG   Brachypodium distachyon: 100834926Help
Entry
100834926         CDS       T01717                                 

Definition
acetyl-CoA carboxylase 1-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
bdi  Brachypodium distachyon
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100834926
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100834926
   00640 Propanoate metabolism
    100834926
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100834926
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100834926
Enzymes [BR:bdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100834926
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100834926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 2246 aa AA seqDB search
MVESGQINSMSNSRHPSLPSEVDEFCKALGGDSPIHSVLVANNGMAAVKFMRSIRTWALE
TFGTEKAILLVAMATPEDLKINAEHIRIADQFLEVPGGTNNNNYANVQLIVEIAERTRVS
AVWPGWGHASENPELPDALKEKGIIFLGPPSAAMAALGDKIGSSLIAQAAGVPTLPWSGS
HVKVPPETCHSIPEDIYKNACVSTTEEAVASCQVVGYPAMIKASWGGGGKGIRKVHNDEE
VRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKHGNVAALHSRDCSVQRRHQKIIE
EGPITVAPPETVKELEQAARRLAKCVQYEGAATVEYLYSMETGEYYFLELNPRLQVEHPV
TEWIAEINLPASQVAVGMGIPLYNIPEIRRFYRMEHGGGYHAWKEISSAATKFDLDKAES
ARPRGHCVAVRVTSEDPDDGFKPTSGRVEELNFKSKPNVWAYFSVKSGGAIHEFSDSQFG
HVFAFGESRSLAIANMVLGLKEIQIRGEIRTNVDYTVDLLNASEYRENKIHTGWLDSRIA
MRVRAERPPWYLSVVGGALYEASSRSSTVVTDYVGYLSKGQIPPKHISLVNLTVTLNIEG
SKYTIETVRGGPRSYKLRINESEIEAEIHSLRDGGLLMQLDGNSHVIYAETEAAGTRLLI
NGRTCLLQKEHDPSKLLADTPCKLLRFLVVDGSHVVSDTPYAEVEVMKMCMPLLLPASGV
IHFVMPEGQAMQASDLIARLDLDDPSSVRRAEPFQGTFPKLGPPTAVSGKVHQKFAASVN
SAHMILAGYEHNINQVVQDLLNCLDSPELPFLQWQEIMSVLATRLPKDLRNELDGKYKEY
ELNADFRKSKDFPAKLLRGVIEANLAYCSEKDRVTNERLVEPLMSLVKSYEGGRESHARV
VVKSLFEEYLSVEELFSDDIQSDVIERLRLQHAKDLEKVVYIVFSHQGVRNKNKLILRLM
EALVYPNPSAYRDQLIRFSALNHTAYSGLALKASQLLEHTKLSELRTSIARSLSELEMFT
EEGERVSTPRRKMAINERMEDLVCAPLAVEDALVALFDHSDPTLQRRVVETYIRRLYQHY
LVRGSIRMQWHRSGLIALWEFSEEHHPIYKRWGVMVVIKSLQFLSTAIEAALKETSHYGA
GVGNISNCNPVTPNSSNMLHIALVGINNQMSTLQDSGDEDQAQERINKLSKILKDNTITS
HLNGAGVRVVSCIIQRDEGRPPMRHSFQWSVDRLYYEEDPMLRHVEPPLSTFLELDKVNL
EGYNDVKYTPSRDRQWHIYTLVKNKKDQRSNDQRMFLRTIVRQPSVTNGFLPGSIDNEVS
RAQASSSFTSNSILRSLMAALEEIELHAHNEAVRSGHSHMYLCIMREQQLFDLIPFSRMS
GEVGQDEATTCTLLKHIVLNIYEHVGVRMHRLSVCQWEVKLWLACDGQANGAWRVVVTNV
TGHTCTVDIYREVEDPNIHQLFYRSATPTAGPLDGVALHEPYKPLDAIDLKRYAARKNET
TYCYDFPLAFETALKKSWKSSISHVGEANEHNRRYVKVTELMFADSTGSWGTPLVPVERS
PGINDIGIVAWSMKLSTPEFPGGREIIVVANDVTFKAGSFGPREDAFFDAVTNLACERKI
PLIYLSATAGARIGVAEEIKSCFHVGWFDDQSPERGFHYIYLTEEDYSRLSSSVIAHELK
LETGETRWVVDTIVGKEDGLGCENLHGSGAIASAYSKAYRETFTLTFVTGRAVGIGAYLA
RLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATNGVVHLTVSDDLEGV
FAILKWLSYVPPYVGGPLPILKPLDPPDRPVTYFPENSCDARAAICGIQDSQGKWLGGMF
DRGSFVETLEGWAKTVITGRAKLGGIPVGVIAVETQTMMQVIPADPGQLDSAERVVPQAG
QVWFPDSATKTAQALLDFNHEELPLFILANWRGFSGGQRDLFEGILQAGSTIVENLRTYK
QPAFVYIPKAGELRGGAWVVVDSKINPEHIEMYAESTAKGNVLEAEGLIEIKFRPKELEE
SMLRLDPELTNLNVRLREMKKENASLSEMETIGVSMTVRMKQLMPIYTQVATRFAELHDT
SSRMAAKGVISKVVDWKESRTFFYKRLRRRVAEDSLAKEVREAAGEQLSHRSALECIKKW
YLASKGSEGDSEQWNDNEGFFAWKDDRRNYENYLEELEAERVSKWFSHLAESSDVKALPN
GLSLLLGKMNPTKREQVIDGLRELLG
NT seq 6741 nt NT seq  +upstreamnt  +downstreamnt
atggtggaatccggccaaataaacagcatgtctaattcgaggcacccatctttaccgtcc
gaggttgatgaattctgtaaagcacttgggggcgactcaccaatacacagtgtgctagtt
gccaacaatggaatggctgcagtcaagttcatgcgtagcatccgcacctgggccttggag
acgtttggaacagagaaggcgattcttttggttgctatggcaactccagaggatctgaag
ataaatgcggagcacataagaatcgccgaccagttcttagaagtacctggcggaacaaat
aataacaactacgctaatgtacagctcatagttgagatagcagagagaactcgtgtttct
gcagtttggcctggctggggtcatgcttcggagaacccagaacttccagatgcgctgaaa
gagaaaggaataatttttcttgggccaccatcagccgcgatggctgctttaggtgataag
attggttcttctcttattgctcaagcagcaggagttccaactcttccatggagtggatca
catgtgaaagtcccgccagaaacctgccactcgatacctgaggatatttataaaaacgct
tgtgtttccactactgaggaagcagtggctagttgtcaggtggtggggtatcctgccatg
atcaaggcatcatggggaggtggcggtaaaggaataaggaaggtacacaacgatgaggag
gtgagagcattgtttaagcaagtgcaaggagaagtccctggatcgcctatatttattatg
aaggtggcatctcagagccgacatttggaggttcagttgctctgtgacaagcatggcaat
gtagcagcactacacagtcgagactgtagtgttcaaagaaggcatcaaaagattattgaa
gaggggccaattacagttgctcctccagaaacagttaaagagcttgagcaggcagcaagg
agactagctaaatgtgtgcaatatgagggtgctgctacagtagaatatctatacagcatg
gaaacaggggaatactatttcctggagcttaatccacgattgcaggtcgaacaccctgtg
accgaatggattgctgaaataaacttgcctgcatctcaagttgcagtaggaatgggcata
cccctgtacaacattccagagatcagacgcttttacagaatggaacatggaggtggctat
catgcttggaaggaaatatcaagtgctgcaaccaaatttgacttggataaagcagagtct
gcaaggccaaggggtcattgtgttgcagttagagttactagtgaagacccagatgatggg
tttaagcctactagtggaagagtggaagagctaaactttaaaagtaaaccaaatgtttgg
gcctacttctctgttaagtctggaggagcaattcatgaattttctgattctcagtttggt
catgttttcgcttttggggaatctaggtcattggcaattgccaatatggtacttggatta
aaagaaatccaaattcgtggagagatacgcacaaatgttgattacacagtggatctattg
aatgcttcagagtaccgagaaaataagatccataccggttggctagatagcagaatagct
atgcgagttagagcagagaggcccccatggtacctttcagttgtgggaggagctctatat
gaagcatcaagtaggagctcaactgttgttacggattatgtcggttatctcagcaaaggg
caaataccaccaaagcacatatctcttgtcaatttgactgtaacactgaatatagagggg
agcaaatatacgattgagacagtaagaggtggacctcgtagctacaagttaaggattaat
gaatcagagatcgaagccgagatacattcgttgcgagatggaggactcttaatgcagttg
gatggaaatagtcatgtaatttatgcggagacagaggcggctggtacgcgcctcctaatc
aatggcagaacatgcttattacagaaagaacacgacccttccaagttgttggctgataca
ccatgcaaacttcttcggtttttggtcgtggatggctctcatgtggtgtctgatacacca
tatgctgaggtagaggtcatgaagatgtgcatgccactgttactacctgcatctggtgtc
attcactttgtcatgcctgagggtcaggccatgcaggcaagtgacctgatagcaaggttg
gaccttgatgacccatcttctgtgaggagagccgaaccatttcagggcacctttccaaaa
cttggacctcctactgctgtttctggcaaagttcaccaaaaatttgctgcaagtgtgaat
tctgcgcacatgatacttgcaggatatgaacataacatcaaccaagttgtacaggatttg
ctaaactgcctagacagccctgagctcccttttctacagtggcaagaaattatgtctgtt
ttagcaacccggcttccaaaagatctcaggaatgagttggatggtaagtacaaggagtat
gagttgaatgctgatttccggaagagcaaggattttcctgcgaagttgctaaggggggtt
attgaggcaaatcttgcatactgttctgagaaagacagggttactaatgagaggcttgtg
gagccacttatgagcctggtcaagtcttacgagggtggaagggaaagccatgctcgtgtt
gttgtgaagtctctgtttgaggagtacttgtctgttgaagaactcttcagtgatgacatt
cagtctgatgtgatagaacgtctacgacttcaacatgcaaaagatctcgagaaggtcgta
tatatagtgttctctcaccagggtgtgagaaacaaaaataaattaattctacggcttatg
gaagcactggtctatccaaatccatctgcttacagggaccagttgattcgcttctccgcc
ctgaaccatacagcatactctgggctggcacttaaagcaagtcaacttcttgagcacacg
aaattgagtgaactccgcacaagtatagcaagaagcctttcagagctggagatgtttact
gaggaaggagagcgggtgtcaacacctagaagaaagatggccatcaatgaaaggatggaa
gatttagtttgtgctccacttgcagttgaagacgcccttgtggctttgtttgatcacagt
gatcctactcttcaacggagagtcgttgagacatacatacgcagattgtatcagcattat
cttgtaaggggcagtatccggatgcaatggcacaggtctggtctaattgctttatgggaa
ttctctgaagagcatcatcccatttataagcgatggggtgtaatggttgtaatcaagtct
cttcagttcttatcaactgcaattgaagctgcattgaaggagacttcacattacggagca
ggtgttggaaacatctcaaattgcaatcctgtaactccaaatagtagcaatatgcttcat
attgctttggttggtatcaacaatcagatgagtactcttcaagacagtggtgatgaggat
caagcacaagaaaggatcaataaactttccaagattttgaaagataacactataacatca
catctcaatggtgctggtgttagggtcgtcagctgcattatccaaagagatgaagggcgt
ccaccaatgcgccactccttccaatggtcagttgacaggctatattatgaggaagacccg
atgctccgccatgtggaacctcctttgtccacattccttgagttggacaaagtgaattta
gaaggctacaatgacgtgaaatacaccccatcgcgtgatcgccagtggcatatttacacc
ctagtaaagaacaaaaaagatcagagatcaaatgatcaaaggatgtttcttcgtaccata
gtcaggcagccaagtgtgaccaatgggtttttgcctggaagtattgataatgaagtaagc
cgtgcccaagcctcttcatcattcacatcaaatagcatactcagatcattgatggcagca
ctagaagaaatagagttacatgctcataatgaggctgtgaggtcaggccattcacacatg
tatctgtgcattatgagagaacaacagttgtttgatctaattccattttcgaggatgtcg
ggtgaagttggtcaagatgaagcgacaacatgcacacttttgaagcatatagttttgaat
atatatgagcatgttggtgtcaggatgcatcgcctttctgtgtgtcagtgggaagtgaag
ctatggttagcctgtgatgggcaagctaatggtgcttggagagttgtcgttacaaatgta
actggccacacctgcactgttgatatttaccgagaagtggaggacccaaatatacatcaa
cttttctaccgctctgccacacccacagctggtcctttggatggtgttgcattgcatgag
ccatacaagcctttggatgctattgacctgaaacgttatgctgctaggaaaaatgaaact
acatactgctatgatttcccattggcatttgaaacagcattgaagaagtcatggaaatct
agtatctctcatgtgggagaagctaacgagcataatcggcggtatgttaaagtgacagag
cttatgtttgctgattctactggatcatggggtactcctttggttccagttgagcgttct
cctggtatcaatgatattggcattgttgcttggagcatgaagctctccacaccagaattt
ccaggaggccgggagataatagttgtcgcaaatgatgtgacatttaaagctgggtccttt
ggtcctagagaagatgcgttcttcgacgctgttactaatcttgcttgtgagaggaaaatt
cctcttatctacttgtcagcaactgctggcgctagaatcggtgtagcagaggaaataaag
tcatgcttccatgttggatggtttgatgatcagagccctgagcgtggttttcattacatt
tacctcactgaagaagactattcaaggctaagctcttcagttatagcccatgagttgaaa
ctggaaactggagagaccagatgggttgttgatactattgttgggaaagaagacggactc
ggttgtgagaatttacacggaagtggtgccattgccagtgcctattctaaggcatatagg
gagacttttactctgacatttgtgactgggcgagctgttggaattggggcctatcttgct
cggttaggcatgaggtgtatacaacgtcttgatcaaccaattattttaactgggttttct
gcgctgaacaaacttctgggccgtgaggtttatagctctcatatgcaactgggtggcccc
aaaatcatggctacaaatggagtcgtccatctgactgtgtcagatgatcttgaaggtgtt
tttgctatcttgaaatggctaagctatgttcctccctatgtcggcggtcctcttcctatt
ctgaaacctcttgacccaccagatagacctgtaacatattttcctgagaattcatgtgat
gcccgtgcagccatctgtggcattcaggacagtcaaggcaagtggttgggtggtatgttt
gatagaggaagctttgtggaaacgttagaaggttgggcaaaaactgttattaccggaaga
gcaaagcttggtggaattccagttggtgtcatagctgtggaaacccagacaatgatgcaa
gtaatccctgctgaccctggtcaacttgattctgctgagcgtgtggtgcctcaagcagga
caggtgtggttcccagattctgccacaaaaacagcccaggcattgctggattttaaccat
gaagaactcccgttgttcatccttgctaactggagaggcttttctggtgggcaaagggat
ctgtttgaaggaatacttcaggctggttctacgattgttgagaatctgaggacatataag
cagcctgcttttgtgtatatcccaaaggctggagagctacgtggaggtgcatgggttgtg
gtggatagcaagatcaatcctgagcacattgagatgtatgctgagagcactgcaaaaggg
aatgtccttgaggcagaagggctgattgagatcaaatttaggccaaaggaacttgaggag
agcatgttaaggcttgaccccgagttgacgaaccttaatgttagactcagagaaatgaag
aaagaaaatgctagcctctctgaaatggaaaccatcggggtgagtatgacagttcggatg
aagcagctgatgcctatatatactcaggttgctacacggtttgctgaattgcatgacacg
tcttccaggatggctgccaaaggtgtgatcagtaaggttgttgattggaaggagtctcga
accttcttctataagagattgcgaaggagggttgctgaggattcacttgccaaagaagtt
agagaagctgctggtgagcagctatcccacagatcagcattggagtgtatcaagaaatgg
tatctagcttccaagggttctgaaggggatagtgaacagtggaatgataatgaaggtttc
tttgcttggaaagacgatcgcaggaactatgagaattatcttgaggagttggaagctgaa
agagtttccaaatggttctcgcatcttgctgaaagctcagacgtgaaagccttaccaaac
ggtctttcactccttcttggcaagatgaatcctacaaaaagggagcaggttatcgatggc
ctcagggagcttctcggttga

DBGET integrated database retrieval system