KEGG   Brachypodium distachyon: 100835003Help
Entry
100835003         CDS       T01717                                 

Definition
(RefSeq) beta-hexosaminidase 3
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00511  Other glycan degradation
bdi00520  Amino sugar and nucleotide sugar metabolism
bdi00531  Glycosaminoglycan degradation
bdi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
bdi00604  Glycosphingolipid biosynthesis - ganglio series
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100835003
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100835003
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100835003
   00604 Glycosphingolipid biosynthesis - ganglio series
    100835003
   00511 Other glycan degradation
    100835003
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100835003
Chaperones and folding catalysts [BR:bdi03110]
 Intramolecular chaperones
  Others
   100835003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 100835003
NCBI-ProteinID: XP_003564819
UniProt: I1HU57
Position
2
AA seq 521 aa AA seqDB search
MAQALRPLLVLLAIGSCIAADHIDLWPMPKSVTHGAQRLYVSKDATMSMVGSTYSDEKAI
LKDAFQRMLDLMKLNHNADDTNRSSFVLTGVNMVVHSPEDELSFGVDESYNLTVPTIGDP
LHAQVEAQTVYGALHALQTFGQLCYFDFTSRLIELNSAPWMITDAPRFPYRGLLIDTSRH
YLPLTTIKGVIDAMTYSKLNVLHWHIIDEQSFPIEIPSYPKLWNGSYSYSERYTMSDAVD
IVRYAEKRGVNVLAEIDVPGHALSWGVGYPSLWPSDSCKEALDVSNNFTFEVIDGILSDF
SKVFKFKFVHLGGDEVNTSCWTKTPHIKEWLNNNHMNASDAYRYFVLRSQKIAIAHGYDV
INWEETFNDFGEKLDRKTIVHNWLGGKVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGFY
MNEPLKGIDNPEQQRLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWTPIEKLAEDP
RSATSRLSRFRCLLNQRGVAAAPLAGDGRTAPYEPGPCVRQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagctctgcggcccctccttgtgttgctggcaattggatcctgcatagctgct
gatcacatcgacttgtggccgatgccaaagtcggtgacccatggagcacagaggctctac
gtcagcaaagatgccacaatgtccatggtgggaagcacgtattctgatgagaaggcaatc
ttgaaggacgccttccagagaatgcttgatttaatgaaactgaaccacaatgcagacgat
acaaaccgaagttcttttgtgctcactggtgttaatatggttgttcattcaccagaggat
gagctaagcttcggggtagatgagtcatacaacttaactgttcctacaattggagatcca
ttgcatgcacaggttgaggctcaaacagtttatggagcacttcatgccttacagaccttt
ggtcaactgtgttattttgatttcacgtcaaggcttattgaactcaactcagctccgtgg
atgattactgatgcaccaagatttccttaccggggccttcttattgatacctcaaggcat
tatcttcctcttacgacaattaaaggagtgattgatgcaatgacatacagtaaattgaac
gttctccattggcatatcatagacgagcagtcatttcctattgaaataccttcataccca
aaactgtggaatggttcatattcttattcggagagatacacaatgtctgatgcagtcgac
attgtaagatatgctgaaaagcgaggtgtaaatgtgttggctgagattgacgttcctggc
catgctctatcatggggtgttggttacccatcattgtggccatcagatagctgcaaagaa
gcacttgatgtcagtaacaactttaccttcgaagttattgatggtattctttcagatttt
agcaaggtgtttaagttcaagtttgtccacttaggaggtgatgaagtcaacacaagctgc
tggaccaaaacaccccacattaaggaatggttgaataataaccacatgaatgcatcagat
gcatacagatatttcgtattaagatcccaaaagatagcgatagcacatggttacgacgtc
attaactgggaagaaacgtttaacgacttcggagaaaaattggaccgtaaaaccattgtg
cataactggcttggagggaaggtagcaccaaaagtggttgctgcagggctgagatgcata
gtaagcaaccaggataagtggtacctagatcacttggatgccacatgggaaggattttac
atgaatgaacccctcaaaggtatcgacaacccagaacagcagcgcttggttattggtggt
gaggtttgcatgtggggagagcagattgatgcatcggatattgaacaaactatttggcca
cgagctgcagcagctgcagagagattgtggactccaattgagaagcttgcagaagaccca
aggtcggccacatcaagactgtcacgcttcaggtgtttgctgaatcagagaggtgtagct
gctgcaccactagctggcgatggtcgtacagcaccatacgaacctggcccctgtgtaagg
caatag

DBGET integrated database retrieval system