KEGG   Brachypodium distachyon: 100835030Help
Entry
100835030         CDS       T01717                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 9-like
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3
AA seq 931 aa AA seqDB search
MTIPSAEGFLPAASCLPCTAEEERAAVDSLTRQAEANVKTGDLRYLVSQSWWNNWQSYVG
LPRHGDNDTDMPSQPTNRPGEIDNSKLVLEETISGSEEPELQRTLREGEDYALVPEEVWR
KLYGWYKGGPVISRKVICEDPNSKRYIVDVYPLRLKLIDERDSSERIIQISRKAKVHELY
QLVCSLISVEQSKLHIWDHFQKMKVKKLTNFNETLEEAQLMMDQEILLEISADDTWSSDL
STRSFNNELAIVPLEPSTSSFSIAGGPTFSNGYSSGIGSSFSQDNSFNPLQRDAEDGYSS
FSNGVKDDMHGLSGLHNLGNTCFMNSAIQALVHTPPLVQYFLKDYSQEINTENPLGLQGE
LAVAFGDLLQKLWSAGRTSVPPRAFKSKLSRFAPQFSGYNQHDSQELLAFLLDGLHEDLN
RVKKKPYIEAKDADGRPEEEFAEECWNNHKARNDSIIVDKFQGQYKSTLVCPECNKISVT
FDPFMYLSLPLPSTVTRMMTVTVFSGTGDSLPMPYTVTVQKNGVCRDLCKALSDACCLKD
SETLLLAEVYDNRMYRYFSPLEQLQIIKDNDKLVAYKLPVGHEKLLRVEILHRKVDRFTP
ELQFNITRKLIGSPLVTCIPNHSTSKADIYAAVTAVLAPFVRAKVHTPDESAVKLNGNGP
SLDGIVLTDNSACSEKGLSTSNLDEETADAELSPSWLSLSDEKGHVRNPIQEDSNHVVGL
PMRLSMDWSDREHEIYNLKYMDDLPDVFKTGFMSKKTRQEAVNLFSCLDAFLKDEPLGPD
DMWYCPSCKEHRQARKKLDLWRLPEILVVHLKRFSYSRYMKNKLDTYVTFPIHDLDMSKY
AKHTSGPPIYELYAVINHYGGLGGGHYSAYAKLVEEESWYHFDDSHVSSINEEETRTSAA
YLLFYRRIDGNACAMSEDVPVDTDMVDSAET
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgacgataccgagcgccgaggggtttctcccggcggcgagctgcctgccgtgcacggcg
gaggaggagcgggcggcggtcgactccctcacgcggcaggccgaggcgaatgtcaagacc
ggcgatctccgctacctcgtctctcagagctggtggaacaactggcaatcttatgtgggc
ttaccccgtcacggggataatgacactgacatgccatcacaacccaccaatagacctgga
gagattgataactcaaagcttgttttggaggagaccatcagtggtagtgaagagccagag
ctccaaagaaccttgagagaaggagaggactacgctttggtgcccgaagaagtttggagg
aaactatatggctggtataaaggtggaccagtaatttctaggaaagtgatttgtgaggac
ccaaattccaagagatacatagtggatgtctatcccctccgtttgaaactaatcgatgaa
agagacagctctgagcggattatccaaataagtaggaaggccaaagttcatgagctttac
caattggtgtgttcacttatttctgtagagcagtctaagctccatatctgggatcatttc
caaaagatgaaggtaaaaaaattgaccaatttcaatgagacactggaggaagctcaactt
atgatggatcaagagattctgttggagataagtgcagatgatacctggagttctgatctt
agtacgagatccttcaacaatgaattagcaatagttccacttgaaccctccacgtcatca
ttttctattgctggaggccctaccttctcaaatggttattcatctggaattggttccagt
ttttcacaagataatagctttaatcctttacaaagggatgcagaagatgggtatagtagt
ttcagcaatggagtaaaagacgacatgcatggattgagtgggttgcataatcttggtaat
acatgcttcatgaatagtgccatacaggccttggtccatacacctccactagtacagtat
tttttgaaggactatagtcaggagataaacacggaaaatccactcgggcttcagggtgaa
ctcgcggtagcatttggagacctactgcaaaaactttggtcagctggtcgaacttctgtt
cctccccgtgcattcaagtcaaaactttctcgatttgctcctcagtttagtggttataat
cagcatgattctcaggagttacttgcatttttgttggatggtctgcatgaagatcttaac
cgtgtgaagaagaaaccatatattgaagctaaggatgcggatggtcgtcccgaagaagaa
tttgctgaagaatgctggaataaccataaagctcgaaatgactccataatagtagataag
ttccagggacaatacaagtccaccttagtctgtccagaatgtaacaaaatctctgtcacc
tttgatccattcatgtatctgtcattgccattgccctcaacagttactcgaatgatgact
gtcactgtatttagtggtaccggggattcacttcccatgccttacactgttacggtacaa
aaaaatggagtttgcagagatctttgtaaagccctgagtgatgcatgctgcttaaaagat
tctgagacattgttacttgcagaggtgtatgataatcggatgtaccgttatttcagtccg
ttggagcaacttcaaattataaaagataatgataagcttgttgcctataaacttccggtt
ggccatgaaaaacttttgagggttgagatcctgcataggaaggtggacagatttactcca
gagctccagttcaatatcactcgaaagctcattggaagccctcttgtaacttgtattcca
aatcactctacaagcaaagctgatatttatgccgctgtgactgctgtgctggctccattt
gtacgagcaaaagtgcatactccagatgagtctgctgttaagttaaatggcaatgggcca
agtctggatggtattgtactaacggataacagcgcctgctctgagaagggtctttctact
tcgaatctggatgaagagacggctgatgctgagctttcaccctcctggctctccttgagt
gatgaaaaaggtcatgtgagaaatcctatacaagaagattctaatcatgttgttggctta
cccatgaggttatcgatggactggtctgatagagaacatgaaatttacaaccttaaatac
atggatgatcttcctgatgttttcaagactggtttcatgtccaagaaaacccggcaagaa
gcagtcaacttattttcatgcttggatgcttttctgaaggacgaacctctgggccctgat
gacatgtggtactgtcctagctgcaaagagcacagacaagcccggaagaaacttgacttg
tggaggttgcctgagatattggtggtccacttaaaaaggttctcatacagccgttatatg
aaaaataagcttgatacctatgtgacctttccaatccatgatcttgatatgagcaagtat
gcgaagcacacatcaggcccccctatttatgaactctatgcagtgataaaccattacggt
ggtttgggaggtgggcactattctgcctatgcgaagttagtagaagaagagagctggtat
cattttgatgatagtcacgtctcctctattaatgaagaggaaacaaggacatctgcagct
tatctactcttctatcgacgtattgatggcaacgcctgtgcaatgtctgaagatgttcca
gttgacactgatatggttgattcagcagaaacatag

DBGET integrated database retrieval system