KEGG   Brachypodium distachyon: 100835224Help
Entry
100835224         CDS       T01717                                 

Definition
phosphoinositide phospholipase C 2-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bdi  Brachypodium distachyon
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bdi00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:bdi04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 602 aa AA seqDB search
MTTYRVCCFLRRFRPASSEPSAAIAAVFRSYASAASAGDVLGEEALKRFLREVQGEEGGS
AGVGDEDEDGGVEALVREIMAFAAQQKLLKKGGGGGGIAAEGFHRWLCSDANAAIHPRRG
VHQDMGQPLSHYYIYTGHNSYLTGNQLSSGSSVAPIVKSLLDGVRVIELDLWPNAGKDDV
EVLHGRTWTSPVGLGECLDAVKEHAFVSSPYPVILTLEDHLTPHLQAKVAKMIKETFGDM
LHISQSETMAEFPSPDDLKGKIIISTKQPKEYLQTKSSKEDSQNGDKEEEESVWGEEIPD
NKAQPAVARQMSEPDNGQGVEEEDEMDKKVQPGVDGEYKRLIAIQLTRRKHDMNEDLKVD
PEKVTRMSLGEKAYEKATITHGADIIRFTQRNLLRIFPRTTRITSSNYNPLMGWRYGAQM
VAANMQGHGRKLWLTQGMFRANGGCGYVKKPDFLMNSDPDKMFDPRSKLPVKTRLKVTLY
MGDGWRFDFHKTHFDKFSPPDFYARVGIAGVAADTRMEESKVVMDNWIPTWDHEFVFSLA
VPELALLRIEVHEADNHQKDDFAGQTCLPVWELRQGIRSVRLCARDGELLRSVKLLMRFE
FA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatacagggtgtgctgcttcctgcggcggttccggccggcgtccagcgagccg
tcggcggccatcgccgccgtcttccggtcctacgcctccgccgccagcgccggtgacgtg
ctcggggaggaggcgctcaagaggttcctccgggaggtgcagggggaggagggcggcagc
gccggcgttggggacgaagacgaagacggcggcgtcgaggcgttggtgagggagatcatg
gcgttcgcggcgcagcagaagctgctgaagaagggcggcggcggcggggggatcgccgcc
gaggggttccaccgctggctctgcagcgacgccaacgccgccatccatcctcgccgcggg
gttcaccaggacatggggcagccgctgtcgcactactacatctacacgggccacaactcg
tacctgacggggaaccagctgagcagcggctccagcgtggcgcccatcgtcaagtccctc
ctggacggcgtcagggtcatcgagctcgacctctggcccaacgccggcaaggacgacgtc
gaggtcctgcacggcaggacatggacgtcgcccgtcgggctcggcgagtgcctggacgcc
gtgaaggagcacgccttcgtctcctctccttaccccgtcatcctcaccctcgaagatcat
ctcaccccccatctccaggccaaagttgcaaagatgatcaaggaaacattcggggacatg
ctccacatctcgcaatccgagaccatggcagagttcccttcccctgatgatctcaagggg
aagatcatcatatcgaccaagcagcccaaggagtacctccagaccaagagcagcaaggag
gattcacagaacggcgacaaggaagaggaggagagcgtttggggagaggagatccccgac
aacaaggcccaacctgccgttgctcgccagatgtcagagccggacaatgggcagggcgtg
gaagaagaggatgagatggacaagaaggtgcagccaggggttgatggcgagtacaagcgc
ctcatcgcgatccaactaacccgaaggaagcacgacatgaatgaggatctcaaggttgac
cccgagaaggtgacgcggatgagcttgggggagaaggcgtacgagaaggccaccatcacc
catggagctgacattatcaggtttacacagaggaatttgctgcggattttcccacggacg
acacgcattacttcctctaattacaatcctctgatgggctggaggtatggagctcagatg
gttgcagcaaacatgcagggccatggaaggaaactatggctgactcaagggatgttcagg
gcaaatggcggttgcggctacgtgaaaaagcccgattttctgatgaacagcgacccggat
aaaatgtttgaccccagatccaagctaccagtgaagacaaggctcaaggtgactctctac
atgggtgacggatggcgattcgacttccacaagacgcatttcgacaagttctcgccaccg
gacttctatgcaagggtgggtatagcaggagtggcagcagacacaaggatggaggagagc
aaggtagtcatggacaactggatcccgacgtgggaccacgagttcgtgttctcgctggcc
gtgccggagctggcgctgctccgcattgaggtacacgaggccgacaaccatcagaaggac
gacttcgccggccagacctgcctaccggtgtgggagctccggcaagggatacgctccgtc
aggctctgcgcgcgcgacggcgagctgctgaggtctgtcaagctcctcatgcgcttcgag
ttcgcctga

DBGET integrated database retrieval system